SecReT6
Protein ID: 26249234
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3399
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3242493..3244130 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ8FEC6
KEGG IDecc:c3399
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 75..135
ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 164..189
Protein Sequence: 545 a.a.     [Download]
>gi|26249234|ref|NP_755274.1| hypothetical protein c3399 [Escherichia coli CFT073]
MWKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNLLTVSFAAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSGVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRHADKAALARKMDALLGSLVAIDPARTAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3242493-3244130 Escherichia coli CFT073 chromosome, complete genome
ATGTGGAAGAGTATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTTCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGCCCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCGGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCCCTGAATCTGCTGACGGTTTCCTTCGCCGCGTGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCACAGTCGGGCGGAATGAAC
GCGGTGGTGCCGCAGAACAGCAGCGGCGTTCCGGCACCGTCATCCCCGGTGGATGCGCCGCAGGTACAGA
CCATCACCTCCGGACGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGAC
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGTCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCCGTT
ATCCGTCAGGACCTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGGCTGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAA
CTGCTGTTTGAAGTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCACATCGCCACGCGGACAAGG
CGGCGCTTGCCCGGAAAATGGACGCTCTGCTGGGTTCGCTGGTGGCAATCGATCCGGCGCGGACAGCGGT
ACTGTGTGATACGCAGCATAAGGACTGA