SecReT6
Protein ID: 26249235
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3400
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3244161..3246965 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ8FEC5
KEGG IDecc:c3400
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-167, Aligned region: 7..540
DUF1305 [PF06996], Evalue: 1.30E-80, Aligned region: 406..422
DUF1305 [PF06996], Evalue: 1.30E-80, Aligned region: 594..894
Protein Sequence: 934 a.a.     [Download]
>gi|26249235|ref|NP_755275.1| hypothetical protein c3400 [Escherichia coli CFT073]
MMDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLP
ELTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLKEFQVLSRPIGERRTRCVYSATRDITLHPLA
LPDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQE
RRVLDAHFSPMGFDDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLA
ENWPHDLPFNTDNLRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQ
AYVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLP
RKALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYD
WTESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGISRCLVTAAPLFRTVCRYPLI
HSTDLNSATHRKVPAMDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDSPATDAVRFR
PHPGMGFPVSELKNVERDAGNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHR
FITQYYRIWRKYNYPASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVT
ALVGLLAPLTKATVVPHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDANSQLLLKLYTEDAAEARGW
LPDGQLHSDLLVLLRVYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLG
RYQGLIPAFSIRNRESMTHVSYSF
 
Nucleotide Sequence: 2805 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3244161-3246965 Escherichia coli CFT073 chromosome, complete genome
TTGATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAAT
TTGCGCAGGCTTACCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGT
GGAGCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCG
GAACTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGG
TTGAACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAAAGAGTTTCAGGTGCTATCCCG
TCCCATCGGCGAACGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCG
TTGCCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCC
CGCTGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGT
AGCCTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGAA
CGCCGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAAGGTG
AGTCAGCGTTCAGCGGCTACCAGTTGTTGCTGGAATATTTCACCTTCCGTGAGAAGTTTATGTTTGTGGC
GCTGAACGGGCTGGAGAACGTCATCTGGCCGGAAAGGATAACCGGCTTTGAGATTGACGTGGTGCTGGCG
GAAAACTGGCCTCATGATTTGCCGTTTAATACCGACAATCTCCGCCTGCACTGCGTGCCGGTCATCAACC
TGTTCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCGCTGGAAAACGAATTTCTGCTGCGCCCGATGCG
CATTCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAG
GCGTATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATT
ACCACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATGCATT
TGATACTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCAGCTTCCC
CGTAAGGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCA
ACCTGTGCGCTCCGACGCAGCCCTGCTATCCCCCTGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGTCA
CCTTGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCACTGTACGAC
TGGACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGC
GTTTTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGG
AGAAGGTATATCACGCTGTTTGGTAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATT
CACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGC
GTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCAATTTTTACCGTTTTTGCCAGTTGCT
GGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCCCGCCACCGATGCGGTGCGCTTTCGT
CCTCATCCCGGTATGGGCTTTCCGGTCAGCGAGTTAAAAAACGTTGAACGTGACGCGGGCAATCCCGACG
CGCCCCCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGGATTCGCCGCTGCCCACCGCCTATCT
GGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGCGTTTCTCGATATTTTTAACCATCGC
TTTATTACTCAGTACTACCGCATCTGGCGCAAATATAACTACCCGGCGTCGTTTGAAGCAGGTGCCGTGG
ATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTCCCGGCAGCGAGAACCATATCGCCAC
GCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCCGACGCGCACGGCGGAAGGCGTCACG
GCACTGGTAGGGCTGCTTGCCCCGCTGACCAAAGCGACGGTGGTGCCTCACGATCCGCAGCCTGTAATTC
TCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGAAAACGCGAACGCTGCTGGGGCGTAC
CGGTACCGACGCCAACAGCCAGTTGCTGCTGAAACTGTATACCGAAGATGCCGCAGAAGCACGTGGCTGG
CTGCCCGACGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGCGTTTATCTGGGCTGGCGCTGTCAGG
CCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCCGGCTGGGAAAACAGCGTGTACAGAT
TAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGACCGGAACAGTGACGGTCAGTCTGGGG
CGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAGAGTATGACTCATGTTTCCTATTCGT
TTTAA