SecReT6
Protein ID: 26249236
SecReT6 ID37
T6SS typei2
Gene symbol-
Locus tagc3401
StrainEscherichia coli CFT073
Repliconchromosome [GenBank: NC_004431] [Browse all T6SS(s) in this replicon]
Location [Strand]3246946..3247482 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ8FEC4
KEGG IDecc:c3401
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|26249236|ref|NP_755276.1| hypothetical protein c3401 [Escherichia coli CFT073]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|26245917|ref|NC_004431.1|:3246946-3247482 Escherichia coli CFT073 chromosome, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGTTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGTGGCT
GCGGCCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGCAGCGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA