SecReT6
Protein ID: 269139774
SecReT6 ID372
T6SS typei4b
Gene symbol-
Locus tagETAE_2429
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2555437..2555901 [+]
Producthypothetical protein
NoteTssB
UniProt IDD0ZB30
KEGG IDetr:ETAE_2429
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-55, Aligned region: 2..146
Protein Sequence: 154 a.a.     [Download]
>gi|269139774|ref|YP_003296475.1| unnamed protein product [Edwardsiella tarda EIB202]
MQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFNDVIKGVHPHLSFRTENT
LSGDDSQLSVDLHFQSMADFTPERVAAQVEPLRKLMDIRSRLSDLKNKMYSNERLGEVLQGIIEDTEKLQ
SLGKETGFGEEKQP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2555437-2555901 Edwardsiella tarda EIB202 chromosome, complete genome
GTGCAGATTACCTATGATGTTGAAATTGGCGATGCGCAGGAAATGAAGGAGCTGCCATTTGTTATGGGAG
TGCTCGGTGACTATTCAGGGCAGCCGGCGACTCCGCTTCCCAAGCTGAAAGAGCGCAAATTCGTTTCGAT
TGATCGCGACAACTTCAACGATGTTATCAAAGGGGTGCATCCCCATCTGTCATTCCGCACCGAGAATACC
CTGAGCGGAGATGACAGCCAACTGTCGGTGGATCTGCATTTTCAGAGCATGGCGGATTTCACCCCAGAGC
GGGTCGCGGCGCAGGTTGAGCCGCTGCGCAAGCTGATGGATATCCGCAGCCGCCTCTCTGACCTGAAAAA
CAAGATGTACAGCAATGAACGCCTGGGTGAGGTATTGCAGGGCATCATTGAGGATACCGAAAAGCTGCAG
AGTCTGGGTAAAGAGACCGGCTTTGGCGAGGAGAAGCAGCCATGA