SecReT6
Protein ID: 269139775
SecReT6 ID372
T6SS typei4b
Gene symbolevpB
Locus tagETAE_2430
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2555898..2557385 [+]
Producttype VI secretion system protein EvpB
NoteTssC
UniProt IDD0ZB31
KEGG IDetr:ETAE_2430
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|269139775|ref|YP_003296476.1| evpB gene product [Edwardsiella tarda EIB202]
MSEQNLPESSAAESAALEGGLLDSIIAETRMARSDLEKARARDLLGEWVSEVLSGTVTVSGDVLASIEAR
IAQIDALLSAQLSAIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRADLIRDFKSAAEFDQSA
LFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSI
PRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGATTVPVESFNFEENVSGKEHGKYLWLNA
AYALGTRLTQAYAKYGWCAAIRGAEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELAELGFIA
LTHCKGTDYAAFFSTQSVQKPKEYDSDSANANARISCQLQYIMATSRFAHYLKSMVRDKIGSFMSRSECE
YFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLP
PPAQG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2555898-2557385 Edwardsiella tarda EIB202 chromosome, complete genome
ATGAGCGAACAGAACTTGCCAGAAAGTAGCGCCGCCGAGAGCGCTGCGCTAGAGGGCGGCCTGCTGGATA
GCATCATTGCGGAAACCCGGATGGCACGCAGTGATCTGGAGAAGGCGCGGGCCCGAGATCTGCTGGGGGA
ATGGGTCAGTGAGGTTCTGTCGGGCACCGTGACGGTATCCGGTGATGTGCTGGCCAGCATTGAGGCGCGT
ATCGCCCAGATCGATGCGCTGCTCTCCGCCCAGCTCTCCGCCATTATGCATGAGCCGGCGTTCCAAAAGC
TGGAGGGGTCATGGCGTGGGCTGCATTACCTGGTGCATCAAAGCGAAACCGGTACCGGCCTGAAAATCCG
CATGCTGAACGTCAGCCGAGCCGATCTGATCCGCGACTTTAAGAGCGCCGCCGAGTTTGATCAGAGCGCG
CTGTTCAAGAAAGTCTATGAGGAGGAGTACGGTACCTTTGGCGGCGCCCCCTTTGCGGCCATGATCGGGG
ATTATGAGTTCAGCAACCACCCGGAAGATCTGTTCCTGCTGGAGGAGATCTCACACGTTGCGGCGGCGGC
CCATGCCCCCTTCCTCTCTGCCGCCAGCGCAGGAATGTTCGGCCTGGATAGCCTGACAGAGCTGTCGATC
CCCCGGGATCTGGCCAAGGGCTTTGATACGGTTGAGTATGCCAAGTGGAAATCGCTGCGCCAGTCGGAGG
ATGCCCGCTATATCGCCCTGGCCCTACCCCACGTGCTTGGCCGACTGCCTTACGGCGCGACGACGGTGCC
GGTCGAGTCATTCAATTTTGAGGAGAATGTCAGCGGCAAGGAGCATGGCAAATATCTGTGGCTGAATGCC
GCCTATGCGCTGGGCACCCGCCTGACTCAGGCCTATGCCAAATATGGCTGGTGCGCCGCCATCCGGGGTG
CCGAAGGGGGAGGCCTGGTGGAGGGACTGCCGGCGCACACCTTTACCACCGATGATGGCGAAGTCGAGCT
CAAGTGCCCCACCGAAGTGGCCATTACCGATCGCCGAGAGAAGGAGCTGGCCGAGCTGGGATTTATCGCC
CTGACCCACTGTAAGGGGACCGACTATGCCGCCTTCTTTTCGACCCAGTCGGTGCAAAAGCCCAAGGAAT
ATGACAGTGACTCCGCCAATGCCAACGCCAGGATCTCCTGCCAGCTGCAATATATTATGGCCACCTCACG
CTTTGCCCATTATTTAAAATCGATGGTCCGCGACAAAATCGGCAGCTTTATGAGCCGCAGTGAATGTGAA
TATTTTCTCAATCAGTGGATCAGTAATTATGTGGTCGGCTCGGATGATGCTGGCCAGGATATCAAGGCGA
AATATCCATTACGGGAAGCCCGCATTGATGTCAGTGATATTCCGGGCAAACCGGGTTTCTATAAGGCGGT
AGCCTATTTAAAACCCCATTTCCAACTGGAGGGGCTGACCGCGTCTTTACGTCTGGTCGCCGATCTGCCG
CCGCCGGCGCAAGGCTAA