SecReT6
Protein ID: 269139778
SecReT6 ID372
T6SS typei4b
Gene symbolevpE
Locus tagETAE_2433
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2559389..2559733 [+]
Producttype VI secretion system protein EvpE
NoteTssE
UniProt IDD0ZB34
KEGG IDetr:ETAE_2433
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-18, Aligned region: 2..97
Protein Sequence: 114 a.a.     [Download]
>gi|269139778|ref|YP_003296479.1| evpE gene product [Edwardsiella tarda EIB202]
MEDVLNTRSALSLDIDQWPELEKSPLNYGLPDCSNLSAANAEDREWIRQHIERAIDLFEPRLSQVRVHIH
LDEKTGISQLIFRIEALLDVDPSPEPVMFDAVLDVSTQLYRIDR
 
Nucleotide Sequence: 345 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2559389-2559733 Edwardsiella tarda EIB202 chromosome, complete genome
GTGGAGGATGTCCTGAATACGCGATCCGCGCTGTCGCTGGATATCGATCAGTGGCCTGAGCTGGAAAAGT
CCCCCCTGAATTACGGCCTGCCGGACTGCTCCAACCTGAGCGCCGCCAACGCCGAGGATCGGGAGTGGAT
CCGCCAGCATATCGAGCGGGCCATCGATCTGTTTGAACCCCGGCTGAGCCAGGTCCGGGTGCACATCCAT
CTGGATGAGAAAACCGGCATCAGCCAGCTGATCTTCAGGATCGAGGCATTACTGGACGTCGATCCCTCGC
CGGAGCCGGTGATGTTCGATGCCGTGCTGGATGTTTCAACACAGCTGTACCGAATAGACAGGTGA