SecReT6
Protein ID: 269139779
SecReT6 ID372
T6SS typei4b
Gene symbolevpF
Locus tagETAE_2434
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2559737..2561578 [+]
Producttype VI secretion system protein EvpF
NoteTssF
UniProt IDD0ZB35
KEGG IDetr:ETAE_2434
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-214, Aligned region: 4..611
Protein Sequence: 613 a.a.     [Download]
>gi|269139779|ref|YP_003296480.1| evpF gene product [Edwardsiella tarda EIB202]
MVELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVHHKIDEQFPEI
TNALLGILYPHYLRPIPSLSLVQFSVDPAQTNLSGPLRLPRHTSLLSRQVDGMACRFRTAYPVEIWPVSV
IHAGFAPARQTSLSVQQQGSAGLICIRLQTHPGHHLNTLGMDRLRFFLQGEPAVVHTLYELLFNNVTKVV
LRAGSAEWTLPASIISPVGFDEDESLFDYDARSSQAYRLLHEYFAFPDKFLFFDMTELLQATPLPEACRE
IDLVIHLSAFEREGRLAKLTDTIDASTFRLGCSPVVNLFRQRAEPLQVTHRKTEYPIIPDVRRPWGMEVY
SVDAVSKLVKHDGQEKIKRYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGMDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDRGDFEVDGGSPVTRIHCLRKPTPTLRPAHGRAAMWRLISHLNLNL
LSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCSRNQAAVVRGIEITLVLDESQ
FEGSGVYLFSAVVERFVSQYGAINSFTRLHVRTRQREQALKRWPPRAGKAVLS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2559737-2561578 Edwardsiella tarda EIB202 chromosome, complete genome
ATGGTCGAGCTATTGCCCTACTATAACCGGGAGCTGGCGTTCTTACGTCAGTTGGGACGTGAGTTCGCCT
CCCAGTATCCCAAGGTGGCCGGACGCCTTCTGCTGGAGGAGGGGGTCTCGGAAGATCCCCATGTCGAACG
GCTGATCGAGGCCGTGGCATTTCTCTGCGCTCGAGTGCACCACAAGATTGATGAGCAGTTTCCCGAAATT
ACCAATGCGCTGCTGGGGATCCTGTATCCCCACTACCTGCGCCCGATCCCCTCGCTATCCCTGGTTCAGT
TTTCGGTCGATCCGGCGCAGACCAACCTATCGGGCCCACTGCGCCTGCCGCGGCATACCAGCCTGCTGTC
TCGCCAGGTAGATGGCATGGCATGCCGGTTTCGCACCGCCTACCCGGTGGAGATTTGGCCCGTGTCGGTC
ATCCATGCCGGCTTCGCCCCCGCGCGGCAAACCAGCCTGTCCGTGCAGCAGCAGGGAAGCGCCGGTCTGA
TCTGTATCCGCCTACAAACCCACCCGGGACATCATCTGAATACCCTGGGGATGGATAGACTGCGCTTCTT
TCTCCAGGGGGAGCCAGCCGTGGTGCACACCCTGTATGAGCTGCTGTTCAACAACGTGACCAAGGTGGTG
CTCCGCGCCGGATCGGCGGAGTGGACCCTGCCGGCCAGCATCATCTCACCGGTCGGATTCGACGAGGATG
AGAGCCTGTTTGACTACGATGCCCGCTCGTCCCAGGCCTACCGCTTACTGCACGAATACTTTGCCTTTCC
CGACAAGTTCCTGTTTTTTGACATGACCGAGCTGCTGCAGGCCACCCCGCTGCCGGAGGCCTGCCGGGAG
ATCGATCTGGTGATCCATCTGTCGGCGTTCGAGCGAGAGGGGCGCCTGGCCAAACTGACCGATACCATCG
ACGCCTCCACCTTTCGGCTGGGATGCAGCCCGGTGGTCAACCTGTTCCGGCAGCGGGCAGAGCCGTTGCA
GGTAACCCACCGTAAAACCGAGTACCCGATTATTCCCGATGTCCGCCGCCCCTGGGGCATGGAGGTCTAT
TCGGTCGATGCCGTCAGCAAGCTGGTCAAGCATGACGGGCAGGAGAAGATAAAACGCTATCGCCCCCTGT
TTGGCCTGCATCACGCCAACGACAGTGAGCCGCAGCGGGTATTCTGGATGGAAAACCGCCGCGGTGGGAT
CCGCGGGGATGACCCGGGCATGGATGTCTACTTATCCCTGGTGGATTTGGATTTTGACCCCAATCAGTCA
TCGTCGGAAACCCTGAGTATCGACGTGACCTGCACCAACCGAGAGTTTCCGTCCCTGCTGCCCTTCGGCG
GCGACCGGGGCGATTTCGAGGTGGACGGCGGCTCTCCCGTCACCCGCATCCACTGTCTGCGCAAGCCGAC
GCCCACCCTGCGCCCGGCCCACGGCAGGGCCGCCATGTGGCGTCTGATCTCCCACCTGAACCTGAACCTG
CTCTCCATCACCGGCGAAAACGAGGAGGCGACCGAGGCCTTCAGGGAGCTGCTCGGACTGTATAACTTCA
GCGACTCCCCCGCCCTGCGTCAGCAGATTGCCGGCATTGTCAGTATCAACAGCCAGCCGGCGACGGCGCG
CCTGTGCAGCCGGAATCAGGCGGCGGTGGTGCGGGGCATCGAAATCACCCTGGTGCTGGACGAGAGCCAA
TTTGAGGGCTCCGGGGTGTACCTGTTCAGCGCCGTGGTGGAGCGATTCGTCAGCCAGTACGGCGCCATCA
ACAGCTTTACCCGCCTGCACGTCCGCACCCGGCAGCGGGAACAGGCGCTCAAGCGCTGGCCGCCGCGGGC
GGGCAAGGCGGTGCTGTCATGA