SecReT6
Protein ID: 269139780
SecReT6 ID372
T6SS typei4b
Gene symbolevpG
Locus tagETAE_2435
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2561575..2562600 [+]
Producttype VI secretion system protein EvpG
NoteTssG
UniProt IDD0ZB36
KEGG IDetr:ETAE_2435
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-100, Aligned region: 16..317
Protein Sequence: 341 a.a.     [Download]
>gi|269139780|ref|YP_003296481.1| evpG gene product [Edwardsiella tarda EIB202]
MNDALSPKSMLEQLYARPYEFDFFQAVRILELQQLRCGCQELPLRFRTHLSLATPASSVYALQPPAADQP
QVMTINFMGLTGPSGALPTRYTEMLLARRLQHRDQTAHHFFDLLNHRLITLFYQAWRKHQATADLECGLQ
ADWRQMLLSLAGLGTLGLQNRLKKDGVNDDVFAYYAGRFGTRSLSEEGLRTLLTDYFSVPVEILPFQGRW
LKLDEADLLTLGRQNCTLGEWPVLGRQVWDAQSQFRIRLGPMSYQQFQPFLPGGKDFRALTKLVRFAIEI
AVTFDIQLVLAASEVPPCTLGDSQAGAARPGWIGWLGGRPARLGDADEVVLQASESGKPAR
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2561575-2562600 Edwardsiella tarda EIB202 chromosome, complete genome
ATGAACGACGCCCTGAGCCCAAAGTCCATGCTGGAGCAGCTGTATGCGCGGCCCTATGAGTTCGATTTTT
TTCAGGCCGTCAGGATACTGGAGCTGCAGCAGCTACGGTGTGGCTGCCAGGAGCTTCCGCTGCGCTTCCG
GACGCATCTCTCCCTGGCCACCCCGGCCAGCAGTGTCTATGCGCTGCAGCCGCCCGCGGCAGACCAGCCG
CAGGTCATGACCATCAACTTCATGGGGCTGACCGGTCCCTCTGGGGCGCTGCCGACGCGGTATACCGAGA
TGCTGCTGGCGCGTCGCCTGCAGCATCGGGATCAGACCGCCCACCACTTTTTTGATCTGCTCAATCACCG
TCTGATCACCCTGTTTTACCAGGCATGGCGCAAGCATCAGGCGACGGCCGATCTGGAGTGCGGCCTGCAG
GCCGACTGGCGCCAGATGCTGCTCTCCCTGGCCGGTCTGGGCACGCTGGGCCTGCAGAACCGGCTGAAAA
AAGACGGCGTCAATGACGATGTCTTTGCCTATTACGCCGGACGGTTCGGCACCCGCTCGCTCAGCGAGGA
GGGGCTGCGCACGCTGCTGACAGACTATTTTTCCGTGCCGGTCGAGATCCTGCCCTTTCAGGGCCGCTGG
CTGAAGCTGGATGAGGCGGACCTCCTCACTCTGGGGCGCCAAAACTGCACTCTGGGAGAGTGGCCGGTGC
TGGGGCGACAGGTATGGGATGCCCAAAGCCAGTTTAGGATCCGCCTCGGCCCCATGAGCTATCAGCAGTT
TCAGCCATTTTTGCCGGGGGGCAAGGACTTTCGGGCGCTGACCAAGCTGGTCCGTTTTGCCATCGAGATC
GCCGTCACATTCGATATTCAGCTGGTGCTGGCCGCCAGCGAGGTCCCCCCCTGCACGCTGGGCGATAGTC
AGGCCGGGGCGGCCCGTCCCGGATGGATTGGCTGGCTGGGAGGCCGTCCCGCCAGGCTGGGGGATGCCGA
CGAAGTGGTATTGCAGGCGTCAGAGTCCGGGAAGCCCGCGCGATAA