SecReT6
Protein ID: 269139781
SecReT6 ID372
T6SS typei4b
Gene symbolevpH
Locus tagETAE_2436
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2562719..2565331 [+]
Producttype VI secretion system protein EvpH
NoteTssH
UniProt IDD0ZB37
KEGG IDetr:ETAE_2436
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-39, Aligned region: 219..241
AAA_2 [PF07724], Evalue: 2.20E-39, Aligned region: 598..765
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 219..349
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 604..688
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 219..295
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 603..720
ClpB_D2-small [PF10431], Evalue: 1.30E-13, Aligned region: 775..845
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 24..74
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 107..132
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 497..505
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 352..385
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 601..691
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 48..77
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 196..240
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 429..523
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 597..648
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 668..692
AAA_16 [PF13191], Evalue: 7.60E-09, Aligned region: 745..794
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 219..242
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 601..625
Sigma54_activat [PF00158], Evalue: 3.70E-05, Aligned region: 214..233
Sigma54_activat [PF00158], Evalue: 3.70E-05, Aligned region: 603..703
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 219..353
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 602..684
AAA_14 [PF13173], Evalue: 3.80E-05, Aligned region: 777..830
IstB_IS21 [PF01695], Evalue: 6.60E-05, Aligned region: 203..278
IstB_IS21 [PF01695], Evalue: 6.60E-05, Aligned region: 603..622
AAA_17 [PF13207], Evalue: 6.80E-05, Aligned region: 219..284
AAA_17 [PF13207], Evalue: 6.80E-05, Aligned region: 602..638
AAA_17 [PF13207], Evalue: 6.80E-05, Aligned region: 798..813
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 219..287
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 605..628
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 219..239
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 466..497
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 602..643
NACHT [PF05729], Evalue: 0.00015, Aligned region: 219..247
NACHT [PF05729], Evalue: 0.00015, Aligned region: 603..628
NACHT [PF05729], Evalue: 0.00015, Aligned region: 805..833
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 211..235
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 601..628
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 219..246
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 275..314
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 343..386
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 463..514
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 601..625
Hpr_kinase_C [PF07475], Evalue: 0.0026, Aligned region: 219..231
Hpr_kinase_C [PF07475], Evalue: 0.0026, Aligned region: 601..622
DUF815 [PF05673], Evalue: 0.0067, Aligned region: 213..294
DUF815 [PF05673], Evalue: 0.0067, Aligned region: 603..643
Protein Sequence: 870 a.a.     [Download]
>gi|269139781|ref|YP_003296482.1| evpH gene product [Edwardsiella tarda EIB202]
MNTDLKALTGKMNQTCHQALEAAAGLCLARGHHEVDIEHVLLKLLETDNTDLARLLQHYGVDAGRFQRDI
ERALDRLKGGCSRQPVLSPHLPRLLSGAWLMASVNCGESQIRSGHLIMALLDDAVLQQLARAMSPEWAAW
SAADLLHQWPALVAGSREATTMSTPGPHAGASPSPALDQYTVNLSERARQGQLDPVLGRDSEIRQMIDIL
LRRRQNNPILTGEAGVGKTAVVEGLALRIAAGEVPDSLRSVALRMLDLGLLQAGASVKGEFERRLKAVID
EVKACSEPVILFIDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQ
AIKVEEPSEEIAMVMLRGMLTKMRQHHQVRILDEAVTAAVRLSHRYLTGRQLPDKAVSVLDTACARIALG
QRTLPAPVEDACRHLEHLQTEITLLEQEQASGLDHGRRLETLQEQARVAREHYQTLEQRWIAECDQVAVI
QALQAQLEQEDGPARAEGLAQLEQAVLALEQMQGRAPLVQTCVDESAIAAVISAWTGIPLGKMVQDELEM
VRQLQTRLAERVIGQPYALETIARGIRLSRAGLEDPNKPIGVFLLVGSSGVGKTETALALAETLYGGERN
LITINLSEFQEAHTVSTLRGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGV
MDDAEGREINFRNTVILLTSNVGSDTLMAYCQDGMTPPEPALLCEALRDELIQTFKPAFLGRLQVVPYYP
VRGAVLKQIIRLKLDKIARRFQRNHQATFHYDEALVDGIAERCTQPESGARLIDNILSAQLLSDMADAVL
ARMAAGEPVSDITVSMDEHGRLTGSLEGSD
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2562719-2565331 Edwardsiella tarda EIB202 chromosome, complete genome
GTGAATACAGATTTGAAAGCCTTGACGGGAAAAATGAACCAGACCTGCCATCAGGCGCTGGAGGCAGCGG
CGGGCCTGTGCCTGGCGCGGGGCCATCACGAGGTCGATATCGAGCACGTGCTGCTCAAGCTGCTGGAGAC
CGACAACACGGATCTGGCGCGCCTGCTGCAGCACTATGGGGTCGACGCCGGCCGTTTTCAGCGGGACATT
GAGCGGGCGCTGGATCGCCTGAAGGGCGGATGCAGCCGGCAGCCGGTGCTCTCCCCCCACCTGCCGCGGC
TGCTGTCTGGTGCCTGGCTGATGGCCTCCGTCAACTGTGGCGAGAGCCAGATCCGCAGCGGTCATCTGAT
CATGGCGCTGCTGGATGACGCGGTGCTGCAGCAGCTCGCCAGGGCGATGTCGCCCGAGTGGGCGGCGTGG
TCAGCGGCAGATCTGCTGCACCAGTGGCCCGCGCTGGTCGCGGGCAGTCGAGAGGCGACGACGATGAGCA
CGCCGGGGCCGCACGCGGGTGCATCTCCCTCGCCCGCCCTGGATCAATACACGGTAAACCTGAGCGAGCG
GGCCCGCCAGGGCCAGCTGGACCCGGTTCTCGGGCGGGATAGCGAGATTCGGCAGATGATCGATATTTTG
CTGCGCCGCAGGCAGAACAACCCGATTCTTACCGGTGAGGCCGGCGTAGGGAAAACCGCCGTGGTTGAGG
GGCTGGCCCTGCGCATTGCGGCCGGCGAGGTGCCGGATAGCCTGCGCAGCGTTGCCCTGCGGATGCTGGA
TCTGGGCCTGCTGCAGGCGGGCGCCAGCGTCAAGGGTGAGTTCGAGCGGCGTCTCAAGGCGGTCATCGAC
GAGGTGAAGGCCTGCAGTGAGCCGGTCATTTTGTTCATCGATGAAGCCCATACGCTGATCGGCGCGGGAG
GCGCGGCGGGTCAGAATGATGCCGCCAATCTGCTGAAGCCGGCGCTGGCCCGCGGTGAGCTGCGCACCAT
TGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATCCCGCCCTGGCGCGGCGCTTCCAG
GCCATCAAGGTGGAGGAGCCCAGCGAGGAGATCGCCATGGTGATGCTGCGCGGCATGCTGACCAAAATGC
GCCAGCACCACCAGGTCCGGATTCTGGATGAGGCGGTGACGGCCGCCGTCAGGCTGTCACACCGCTATTT
GACCGGCAGACAACTGCCGGACAAGGCGGTCAGCGTGCTGGATACCGCCTGCGCCCGCATTGCGCTCGGG
CAACGTACCCTGCCGGCCCCCGTCGAGGATGCCTGCCGCCATCTGGAGCATCTCCAGACCGAGATCACGC
TGCTGGAGCAGGAGCAGGCCAGCGGCCTCGATCATGGTCGCCGCCTGGAGACGCTGCAGGAGCAGGCCCG
GGTCGCCCGGGAGCACTATCAGACCCTGGAGCAGCGCTGGATCGCGGAGTGTGATCAGGTCGCCGTCATT
CAGGCTCTGCAAGCGCAGCTGGAGCAGGAGGATGGCCCGGCGCGCGCTGAGGGGCTGGCCCAGCTGGAGC
AGGCCGTTTTGGCGCTTGAGCAGATGCAGGGCCGGGCGCCGCTGGTGCAGACCTGTGTGGATGAGTCCGC
CATTGCGGCGGTGATCTCGGCATGGACGGGGATTCCGCTGGGCAAGATGGTTCAGGATGAGCTGGAGATG
GTTCGCCAGCTGCAGACGCGGCTGGCCGAGCGGGTCATCGGGCAGCCCTATGCCCTGGAGACCATCGCCC
GGGGGATTCGCCTGTCCCGCGCGGGGCTCGAGGATCCCAACAAGCCCATCGGCGTGTTTCTGCTGGTCGG
CTCCAGCGGCGTGGGAAAGACCGAGACCGCGCTGGCGCTGGCCGAAACCCTGTATGGCGGCGAACGCAAC
CTGATCACCATCAACCTGTCGGAGTTTCAGGAGGCCCATACCGTTTCGACGCTGCGGGGCTCGCCGCCGG
GCTACGTCGGCTACGGAGAGGGCGGCGTGCTGACGGAGGCGGTACGCCGCAAACCCTACAGCGTGGTGCT
GCTGGATGAGGTGGAGAAAGCCCACCCGGATGTCCTGGAGCTGTTCTTCCAGGTGTTTGACAAGGGGGTC
ATGGACGATGCCGAGGGGCGGGAGATCAACTTCCGCAATACCGTCATACTGCTGACCTCCAACGTCGGCA
GCGACACCCTGATGGCCTACTGTCAGGACGGCATGACGCCGCCCGAACCGGCGCTGCTGTGTGAGGCGCT
GCGGGATGAGCTGATCCAGACCTTCAAGCCGGCCTTCCTCGGACGCCTGCAGGTAGTGCCCTACTACCCG
GTGCGGGGCGCGGTGCTAAAACAGATTATCCGCCTCAAGCTGGATAAGATTGCCCGCCGCTTCCAGCGCA
ATCATCAGGCCACCTTCCATTACGATGAGGCCCTGGTGGATGGCATCGCCGAGCGCTGTACCCAGCCGGA
GAGCGGCGCCCGCCTGATCGATAACATTCTGTCGGCCCAGCTGCTGTCCGATATGGCGGACGCGGTGCTG
GCGCGCATGGCCGCCGGTGAGCCGGTGTCCGATATCACCGTCTCGATGGATGAGCACGGCCGACTGACGG
GATCGTTAGAGGGGAGTGACTGA