SecReT6
Protein ID: 269139784
SecReT6 ID372
T6SS typei4b
Gene symbolevpK
Locus tagETAE_2439
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2567727..2568794 [+]
Producttype VI secretion system protein EvpK
NoteTssA
UniProt IDD0ZB40
KEGG IDetr:ETAE_2439
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 237..252
Herpes_UL17 [PF04559], Evalue: 0.0046, Aligned region: 158..253
Protein Sequence: 355 a.a.     [Download]
>gi|269139784|ref|YP_003296485.1| evpK gene product [Edwardsiella tarda EIB202]
MTILDMARLLAPIGEAHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQANWVEVIRLTSEALAT
RSKDLQLAVWLCEALVQRHGLPGLREGLLLLDSLLERYWAEMYPALSDGDLEGRVSRLEWLNQILPPALG
LLPLTAAQDGRAYGWLDWQVSREVDNLKRLNNEAAQAALSEGKLDPDAWDLAVSHTPGAFYLTLQDDLQQ
AIRAFQGLSQRLDPLFGRDAPRISDVAERLEQMLRLVTRLVEGKGMARPREAQERAEAPAGAETAAVNAS
SPGVAGAPRTREEAIRQLSGIAAFFKETEPHSPVSYIVDKAARWGNMRLDEWIREVVEDDGTRRMLKGVL
GYDEE
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2567727-2568794 Edwardsiella tarda EIB202 chromosome, complete genome
ATGACTATCTTAGATATGGCGCGCTTGCTGGCCCCGATCGGTGAAGCTCATCCGGCGGGAGAGGATATCA
GCTTCGACCCGCTGTATGACCAGATTCGGGAGGCCCGCCGGGCCGATGCCGACTACCTTGGGCAGGGAGA
GTGGGTCAGCTCGCTCAAGCAGGCCAACTGGGTCGAGGTGATCCGCCTGACCAGCGAGGCGCTGGCGACG
CGCAGCAAAGATCTGCAGCTGGCGGTGTGGCTGTGCGAAGCCCTGGTGCAGCGGCATGGGCTGCCGGGGC
TGCGCGAGGGGCTGCTGTTACTGGATAGCCTGCTGGAGCGCTATTGGGCGGAGATGTATCCGGCGCTGAG
CGACGGGGATCTGGAGGGGCGGGTGAGCCGTCTGGAGTGGCTCAATCAGATCCTTCCCCCGGCGCTGGGC
TTGCTGCCCCTGACGGCCGCCCAGGATGGACGCGCCTACGGCTGGCTGGATTGGCAGGTCTCCCGAGAGG
TCGATAACCTGAAGCGGCTGAACAATGAGGCGGCTCAGGCGGCCCTCAGCGAAGGAAAGCTGGATCCGGA
TGCCTGGGATCTCGCCGTCAGCCATACGCCCGGCGCCTTTTACCTGACGTTACAGGACGATCTGCAGCAG
GCCATCCGCGCATTCCAGGGATTATCCCAGCGGCTCGACCCCCTATTTGGGCGGGATGCCCCGCGGATCA
GCGATGTGGCTGAGCGGCTGGAGCAGATGCTCAGGCTGGTGACGCGGCTGGTAGAGGGTAAGGGCATGGC
GCGACCCCGCGAGGCCCAGGAGCGCGCAGAGGCGCCGGCGGGCGCAGAGACCGCCGCGGTTAACGCTTCC
TCTCCCGGCGTGGCCGGCGCCCCCCGAACCCGCGAGGAGGCCATTCGGCAGCTCAGCGGCATCGCCGCGT
TTTTCAAGGAGACCGAACCGCACAGCCCCGTCTCCTACATCGTGGATAAAGCCGCCCGCTGGGGCAATAT
GCGACTGGATGAGTGGATCCGAGAGGTGGTGGAAGATGACGGCACCCGGCGGATGCTCAAAGGTGTATTG
GGCTATGATGAAGAATAA