SecReT6
Protein ID: 269139786
SecReT6 ID372
T6SS typei4b
Gene symbolevpM
Locus tagETAE_2441
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2569522..2570910 [+]
Producttype VI secretion system protein EvpM
NoteTssK
UniProt IDD0ZB42
KEGG IDetr:ETAE_2441
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-90, Aligned region: 19..460
Protein Sequence: 462 a.a.     [Download]
>gi|269139786|ref|YP_003296487.1| evpM gene product [Edwardsiella tarda EIB202]
MKIHKPVYWHQGMFLQPQHFQLADLHSQFQLKPFLDSGLQDFWGVGALTISESALGNQQLNILSAELLFR
DHSYVVWPGNTICKPRSFASAWQDQSRPFNVYLGLKKLDTIESNVAVVPQLEDGAGRNVRCVTTQQGDKH
ADLYSDGPEAEIQSLHYVLQVLWESEVEKLTDYNILPIARLERQGEVVQLSKSFIPPCYIMGGSETLMRV
VRDVRDDLAGRARQLEAYKSPREIRKAEFDASFLMFLLALRTLNRYVPLLYQLTESPQVHPRKVYDMLRQ
IVGELSTFSERCDMLGSSGENSPGLPPYRHQDIAPGLLTVRDLIIRLLNEISIGPDFLIALEPSGEYLTA
RLPKSLLEDRNRFYLIVRSDMAPDTLQAAFRARARLAEADALPLLIQRALPGITLTPLSSVPEGLPRRSC
SFYFQIDTQSEAWRQVAESCHVAFNWFDAPDDLKVELVGVSR
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2569522-2570910 Edwardsiella tarda EIB202 chromosome, complete genome
ATGAAAATTCACAAACCAGTTTATTGGCATCAGGGCATGTTTTTACAGCCGCAGCATTTTCAGCTGGCAG
ACCTGCATAGCCAATTTCAGCTCAAGCCATTCTTGGACTCCGGACTGCAGGATTTTTGGGGAGTGGGAGC
GCTGACCATTTCGGAGTCAGCCCTAGGCAACCAGCAGCTCAATATCCTGTCGGCTGAGCTGCTCTTCCGC
GACCACAGCTATGTCGTATGGCCGGGCAATACCATCTGTAAGCCGCGCTCCTTCGCCTCTGCCTGGCAGG
ATCAGAGCCGGCCGTTCAATGTCTACCTGGGGCTGAAAAAGCTGGACACGATAGAGTCCAATGTGGCCGT
CGTGCCACAGCTTGAGGATGGCGCAGGGCGGAACGTCCGCTGCGTGACGACCCAGCAGGGAGACAAGCAC
GCGGACTTATATTCGGATGGGCCTGAAGCCGAGATCCAGAGCCTGCACTACGTGCTGCAGGTGCTGTGGG
AGAGCGAGGTTGAAAAGCTGACGGATTACAATATCCTGCCCATCGCCCGGCTGGAGCGCCAGGGCGAGGT
GGTTCAGCTGTCCAAGAGCTTCATTCCGCCGTGCTACATCATGGGCGGCTCCGAGACCCTGATGCGGGTG
GTCCGGGATGTCCGGGACGATCTGGCGGGGCGCGCCCGCCAACTGGAGGCCTATAAAAGCCCGCGCGAAA
TCCGCAAGGCGGAGTTCGATGCCAGCTTTCTGATGTTTCTGCTGGCCCTGCGCACCCTCAACCGCTACGT
GCCGCTGCTGTACCAGCTGACCGAATCGCCGCAGGTCCATCCGCGCAAGGTCTACGACATGCTGCGGCAG
ATCGTCGGCGAGCTGTCCACCTTCAGCGAGCGCTGCGACATGCTGGGCTCCAGCGGCGAAAACAGCCCGG
GGCTCCCCCCCTACCGCCATCAGGACATCGCGCCGGGGCTGTTAACCGTACGCGATCTGATTATTCGTTT
ATTGAATGAAATATCGATCGGACCCGATTTCCTGATCGCCCTGGAGCCGAGCGGGGAGTACCTGACGGCG
CGGCTCCCCAAGAGCCTGCTGGAAGATCGTAACCGCTTCTACCTGATCGTCCGCAGTGACATGGCGCCGG
ATACCCTGCAGGCCGCCTTCCGGGCCCGCGCCAGGCTGGCCGAGGCCGACGCATTGCCCTTACTGATCCA
GCGCGCCTTGCCGGGGATCACGCTGACGCCGCTATCGTCCGTTCCCGAAGGCTTGCCCCGGCGCTCCTGC
TCGTTTTATTTCCAGATCGATACCCAAAGTGAAGCCTGGCGGCAGGTCGCCGAGAGTTGCCACGTCGCGT
TCAACTGGTTCGATGCCCCAGATGACCTCAAAGTAGAATTGGTAGGAGTGAGCCGGTGA