SecReT6
Protein ID: 269139787
SecReT6 ID372
T6SS typei4b
Gene symbolevpN
Locus tagETAE_2442
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2570907..2571557 [+]
Producttype VI secretion system protein EvpN
NoteTssL
UniProt IDD0ZB43
KEGG IDetr:ETAE_2442
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-39, Aligned region: 2..204
Protein Sequence: 216 a.a.     [Download]
>gi|269139787|ref|YP_003296488.1| evpN gene product [Edwardsiella tarda EIB202]
MSLSEAFIQPMLYVRQYLQAPEGEASLFRERLQSYLHHSQLRAQEAGESPAAIDSALYAVVAWMDETIMC
STWDGVATWRRDPLQASYFNTVCAGVDFFDKLTALSPEADDVREVYLLCLALGFEGRYAGPAGQTALTQI
RVHQLRDLHGEVWEASRRLFPEAYPRSSVTPTQQTRWLTQSRFTTIVVPLVILVALYGILNWVLYEYADL
ALEWLP
 
Nucleotide Sequence: 651 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2570907-2571557 Edwardsiella tarda EIB202 chromosome, complete genome
GTGAGTTTATCGGAAGCGTTTATTCAGCCCATGCTCTACGTGCGGCAGTATCTCCAGGCGCCCGAAGGCG
AGGCGTCATTATTCCGTGAGCGGCTGCAGTCATACCTGCACCACAGCCAGCTCCGGGCCCAAGAGGCGGG
GGAAAGTCCGGCCGCGATCGACTCCGCCCTGTATGCCGTTGTGGCCTGGATGGATGAGACCATCATGTGT
TCGACGTGGGACGGCGTGGCGACATGGCGACGTGACCCCCTGCAGGCCAGCTACTTCAACACCGTCTGCG
CCGGGGTTGACTTCTTCGACAAGCTGACCGCCCTGAGCCCCGAGGCCGATGACGTCAGGGAGGTCTATCT
GCTGTGCCTGGCCCTGGGATTTGAGGGGCGCTATGCCGGCCCGGCGGGCCAGACCGCGCTGACGCAGATC
AGGGTGCACCAGCTGAGGGATCTGCACGGCGAGGTATGGGAGGCGTCGCGACGTTTATTTCCAGAGGCCT
ACCCGAGATCCTCGGTCACGCCGACGCAGCAAACGCGATGGCTGACCCAAAGCCGCTTTACCACCATCGT
CGTGCCGCTGGTCATCCTGGTCGCCCTGTACGGCATTTTAAACTGGGTATTATATGAATACGCGGATCTC
GCGCTGGAGTGGCTGCCATGA