SecReT6
Protein ID: 26989333
SecReT6 ID13
T6SS typei1
Gene symbolvgrG-1
Locus tagPP_2614
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2989308..2991476 [-]
ProductvgrG protein
NoteTssI
UniProt IDQ88JN5
KEGG IDppu:PP_2614
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-54, Aligned region: 28..350
Phage_base_V [PF04717], Evalue: 1.00E-19, Aligned region: 391..484
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 549..571
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 556..573
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 565..586
Gp5_C [PF06715], Evalue: 4.50E-06, Aligned region: 610..620
Protein Sequence: 722 a.a.     [Download]
>gi|26989333|ref|NP_744758.1| vgrG-1 gene product [Pseudomonas putida KT2440]
MPSQSDLRYSFEALVGKAAFEVVSFELREGISAPFELELKLISFENDIDFGHLLDKPVLFTILDGERPVR
YVHGLVSSFSQGESGFYRTYYHALVEPQLARARLRSNWRIFQHKTVPQILELMLKRQGIDQYELRASMDH
QVREFCVQAGETDLAFIARLAAEEGFVYRFAHSEKLHKLIITDRLQSLGLISHGAIKADHEDEGFGDDDE
PVGPDSVLYQANSGGDQAIPCLRRLRYSEQVRTARQVQRDHTFTHPAYRQEHRAAGPFLEHQSKDYEYFD
YPGRYKRDAVGKPFTENRITALRHDVRIAEVQGDDVRLQPGLSFTLTDHPREDLNVHWRVSTVHHEGSQP
TSLQEEAAGADQGTRYEQKAVLVPGRTEWRPAPLPKPRVDGPHMATVVGPPGEEIYCDEWGRVKVSFPWD
RESQNNEFSSCWLRVSQGWAGGSWGSMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGNQLPPYDLPRHKT
RMTIKSQTHKGDGFNELRFEDELGQEEVFIHAQRDQNNVVKHDETTQVGNDRKEQVDNDESILIGHDRTE
TVGNDERITIGQDAALDIGRNHTIRIAKDRVENIGNHRHDQIAANHHTRIGGNFEQRVEGHAELEARGDI
RRRTRRYELRASEAVVIQGPGGSIRIDETGITLDSPTIRITGQMLKSANGTTSPFSISSAPNTGKPLERL
CGRRPDGSCPLPDCRCIRGQVQ
 
Nucleotide Sequence: 2169 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2991476-2989308 Pseudomonas putida KT2440 chromosome, complete genome
ATGCCTAGCCAATCTGATTTGCGCTACAGCTTTGAGGCACTCGTTGGCAAAGCTGCATTCGAAGTGGTGT
CGTTCGAACTCCGCGAGGGCATCAGCGCACCCTTTGAACTGGAGCTGAAACTGATCAGCTTCGAAAACGA
CATCGACTTCGGCCATTTGCTCGACAAACCCGTGCTCTTCACCATCTTGGACGGAGAACGCCCGGTACGG
TACGTGCACGGCCTTGTCAGCAGCTTCAGCCAGGGCGAGAGCGGCTTCTACCGCACTTACTATCACGCCT
TGGTCGAACCGCAACTGGCCCGCGCAAGGCTGCGCTCGAACTGGCGCATCTTCCAGCACAAGACCGTTCC
GCAAATTCTCGAGCTGATGCTCAAGCGTCAAGGCATCGACCAGTACGAACTACGCGCCAGCATGGACCAT
CAGGTGCGCGAATTCTGCGTTCAGGCCGGTGAGACGGACTTGGCGTTCATCGCCCGCCTTGCCGCTGAAG
AAGGCTTCGTCTACCGCTTTGCGCACAGTGAAAAGCTGCACAAGCTGATCATCACCGATCGGCTGCAGTC
CCTCGGCCTGATCAGCCATGGCGCCATCAAGGCCGACCATGAAGACGAGGGTTTCGGCGATGACGACGAG
CCTGTAGGCCCTGACAGCGTCCTGTACCAAGCGAACAGCGGTGGCGATCAAGCCATACCCTGCCTTCGCC
GCTTGCGCTACAGCGAGCAGGTGCGCACCGCTCGCCAGGTGCAGCGCGACCACACCTTCACCCACCCGGC
CTACCGCCAGGAGCACAGAGCCGCCGGGCCCTTCCTGGAGCATCAGAGCAAAGATTACGAATACTTCGAT
TACCCAGGCCGCTATAAACGCGATGCCGTGGGCAAGCCGTTCACCGAAAACCGCATCACAGCGCTGCGCC
ATGATGTGCGTATTGCCGAGGTCCAGGGCGATGACGTGCGCCTGCAACCGGGGCTCAGTTTCACCCTGAC
CGACCACCCGCGCGAAGACCTGAATGTGCATTGGCGGGTCAGCACGGTCCACCACGAAGGCAGCCAGCCC
ACCAGCCTGCAGGAAGAAGCTGCCGGGGCCGACCAGGGCACACGTTACGAGCAAAAGGCGGTACTGGTGC
CAGGCAGAACCGAGTGGCGCCCAGCTCCGTTGCCCAAACCACGCGTTGACGGCCCGCACATGGCCACCGT
CGTCGGCCCGCCTGGCGAGGAAATCTACTGCGATGAATGGGGCCGGGTAAAAGTCAGTTTCCCCTGGGAC
CGCGAAAGCCAGAACAACGAGTTCAGTTCGTGCTGGCTGCGGGTGTCTCAAGGCTGGGCGGGTGGCAGCT
GGGGCTCGATGGCCATCCCCCGGATCGGCCAGGACGTGATCATCCATTACGTCAACGGCGACCCCGATCA
GCCGATGATCACCGGCCGTACTTACTGCGGCAACCAGCTGCCACCGTACGACCTTCCCCGTCACAAGACC
CGCATGACCATCAAGAGCCAGACCCACAAGGGCGATGGCTTCAACGAGCTGCGCTTCGAGGACGAACTGG
GCCAGGAGGAAGTGTTCATTCATGCCCAGAGGGACCAGAACAATGTGGTCAAGCATGATGAGACTACGCA
GGTCGGCAATGACCGCAAAGAGCAGGTCGATAACGACGAATCGATCCTGATCGGCCACGACCGTACGGAA
ACGGTTGGCAATGACGAGCGCATCACCATTGGGCAGGATGCCGCGCTCGACATCGGTAGAAACCACACGA
TCAGGATCGCCAAGGACCGTGTCGAAAACATCGGCAATCACCGTCACGATCAGATCGCCGCCAATCACCA
CACCCGTATCGGTGGCAACTTCGAGCAACGGGTCGAAGGGCATGCCGAGCTGGAAGCCCGTGGGGATATC
CGCAGACGTACTCGCCGTTATGAACTTCGAGCATCGGAAGCCGTGGTCATCCAAGGCCCTGGTGGCTCCA
TTCGAATCGACGAAACAGGCATCACACTGGACAGCCCGACGATTCGCATCACCGGCCAGATGCTCAAGTC
GGCAAATGGAACGACAAGCCCCTTTTCCATCAGCAGTGCACCGAACACTGGCAAGCCGCTGGAGCGCCTG
TGTGGGCGCCGCCCTGATGGCTCCTGTCCCCTACCCGATTGCCGCTGTATCCGAGGGCAAGTCCAATGA