SecReT6
Protein ID: 26989335
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2616
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2992200..2993069 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ88JN3
KEGG IDppu:PP_2616
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-64, Aligned region: 67..272
Protein Sequence: 289 a.a.     [Download]
>gi|26989335|ref|NP_744760.1| unnamed protein product [Pseudomonas putida KT2440]
MGKDNNTPTDENNAAVNALDSTLQQPVPAPRAAATNGQASTDKPEPEPVSEGYPADPEFQLRGGFANLML
DAASPLFGLVIRLRTLDELPNIQDVHQQVRSQIDNIQEEMRQHGYEPAQLLAYSYGLCLFIDEAVMERPW
GKSSCWSQEPLLSIFHDETWGGEKIFTVITRLMQEPKRYQDVLEFMYFALCLGLKGKYALAPKGEETLNA
LIHQLHGIIRELRGPTPEEVCDPYTNVAPRNFRMSRQWPWWSPLVISAIAMAVAYGIYSYRLHLITTEVL
ESLNGILQQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2993069-2992200 Pseudomonas putida KT2440 chromosome, complete genome
ATGGGAAAAGACAACAATACGCCCACCGATGAAAACAACGCTGCAGTCAACGCGCTTGATTCAACCCTTC
AACAGCCAGTACCCGCCCCCCGGGCTGCAGCAACCAATGGGCAAGCATCCACGGACAAACCTGAGCCAGA
GCCCGTTTCCGAAGGCTACCCCGCTGACCCGGAATTTCAGCTGCGGGGCGGCTTCGCCAACCTGATGCTG
GATGCCGCATCACCGTTGTTCGGCTTGGTCATACGCCTGCGTACGCTGGACGAGCTGCCGAACATCCAGG
ACGTGCACCAGCAAGTACGCAGCCAGATCGACAACATTCAGGAAGAAATGCGCCAGCACGGTTACGAGCC
GGCTCAGTTGCTGGCGTACTCCTACGGTCTGTGCCTGTTCATAGACGAGGCCGTTATGGAGCGGCCCTGG
GGCAAGAGCAGCTGCTGGAGCCAGGAGCCGCTGCTCAGCATCTTCCACGACGAGACCTGGGGTGGGGAAA
AAATCTTCACCGTGATTACCCGCCTGATGCAGGAGCCCAAGCGTTATCAGGACGTACTGGAGTTCATGTA
CTTCGCCCTGTGCCTTGGGCTGAAGGGCAAGTACGCGCTCGCGCCGAAAGGCGAAGAAACACTCAACGCA
TTGATTCACCAACTGCACGGGATCATCCGCGAACTGCGCGGCCCTACCCCCGAAGAAGTCTGCGACCCCT
ACACCAATGTGGCCCCACGCAACTTCCGCATGAGCCGGCAATGGCCCTGGTGGAGCCCCTTGGTGATTTC
CGCCATCGCCATGGCGGTGGCCTACGGGATCTACAGCTACCGCCTGCACCTGATCACAACCGAGGTGCTG
GAGTCGCTGAACGGCATTTTGCAGCAATAG