SecReT6
Protein ID: 26989336
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2617
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2993071..2994408 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ88JN2
KEGG IDppu:PP_2617
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-151, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|26989336|ref|NP_744761.1| unnamed protein product [Pseudomonas putida KT2440]
MSSRNPVLWPEGLFVKPQHFQQAARASEAALHQRLASLNAAFYGFSELQLNDEYLSLGKVAITRARGVMP
DGTVFDIPADLPPPPPLEIGDDACQDSEVYLCLPLRTDGGREVSWPDNAANFRYTAQVQEIKDTHSADGD
LVQVDLAVPNLQLKRKTEDSSAYTRLALARILERRPDGSLQLDEAFYPTSVSVRAVPALQRFLEEITHTL
RERARGLATRIGASGQSGIADIRDFNLLQAMNRWWPCFQHLARQAQTHPEQLYLCMSQACGEFVTFTDQN
RLPQEYPAYHHTALRTSFKPLEDTLRRSLSTVLRPRAVSLPLESEQFGVMTTTLEDRRLIDEADFILAVR
ASMPPQALRQMFIQKAKITSLESLNDLVPLQLPGIPLLPLPVAPRDLPFHAGFSYFELDRRDPAWACMSK
ANGFGIHIAGDFPGLELQFWAIRSE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2994408-2993071 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGTTCACGCAATCCCGTTCTCTGGCCCGAAGGCCTGTTCGTCAAACCACAGCATTTCCAACAGGCGG
CCAGGGCCAGCGAAGCAGCCCTGCACCAGCGCCTCGCCAGCCTCAATGCAGCCTTTTACGGCTTCAGCGA
ACTTCAGTTGAACGACGAATACCTGAGCCTGGGCAAAGTCGCCATCACCCGGGCGCGAGGTGTGATGCCG
GACGGCACGGTGTTCGACATTCCCGCCGACCTGCCGCCACCGCCGCCGCTGGAAATCGGCGACGACGCGT
GCCAAGACAGTGAGGTGTATCTGTGCCTGCCGCTGCGTACCGATGGCGGCCGCGAAGTGAGCTGGCCCGA
CAATGCAGCCAATTTCCGCTATACCGCTCAGGTACAGGAAATCAAGGATACCCACTCCGCTGACGGTGAC
CTGGTGCAGGTAGACCTTGCGGTGCCCAACCTGCAGCTCAAACGCAAGACCGAAGACAGCAGCGCCTACA
CCCGCCTGGCCCTGGCACGTATTCTGGAACGGCGCCCCGACGGCAGCCTGCAACTGGACGAAGCGTTCTA
CCCCACCAGCGTTTCGGTGCGGGCGGTGCCAGCGCTGCAGCGGTTTCTAGAGGAAATCACCCATACCTTG
CGCGAGCGGGCGCGCGGCCTTGCCACGCGGATTGGTGCCTCGGGCCAGTCCGGGATCGCCGACATTCGCG
ACTTCAACCTGCTGCAGGCCATGAACCGTTGGTGGCCATGCTTCCAGCATCTGGCCAGGCAAGCGCAAAC
GCACCCCGAGCAGCTGTACCTGTGCATGAGCCAGGCCTGCGGCGAATTCGTCACCTTCACCGACCAGAAC
CGGCTGCCGCAGGAGTACCCCGCCTATCACCACACCGCACTGCGCACGTCTTTCAAACCGCTGGAAGATA
CCTTGCGCCGGTCTCTGAGCACCGTCTTGCGGCCACGCGCTGTTTCACTACCGCTGGAGAGCGAACAATT
CGGCGTGATGACGACCACGCTGGAAGACCGCCGGCTGATCGACGAAGCCGACTTCATCCTCGCCGTGCGC
GCCAGCATGCCACCACAGGCGTTGCGCCAGATGTTCATCCAGAAAGCCAAGATCACCTCACTTGAGTCAC
TGAATGACCTGGTGCCGCTGCAATTGCCGGGCATCCCTTTGCTGCCATTACCCGTGGCGCCCCGCGACCT
GCCCTTCCATGCGGGTTTCAGCTACTTCGAGCTGGACCGACGTGACCCGGCCTGGGCGTGCATGAGCAAG
GCGAATGGCTTCGGCATCCACATTGCGGGCGACTTCCCAGGGCTTGAACTGCAGTTCTGGGCGATCAGGA
GTGAGTGA