SecReT6
Protein ID: 26989337
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2618
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2994464..2995261 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ88JN1
KEGG IDppu:PP_2618
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-24, Aligned region: 17..63
T6SS-SciN [PF12790], Evalue: 2.30E-24, Aligned region: 156..256
Protein Sequence: 265 a.a.     [Download]
>gi|26989337|ref|NP_744762.1| unnamed protein product [Pseudomonas putida KT2440]
MKPHPLLLASLLLALVAPTGCTSLSRMSQVAMDHSLPIGPPKDHPTEVAFSINASPTLNGNPDSLDVAAD
QDRALEPSPYAVTLSAGDPYALTEKIGVLFEYLQAQFPAMSPVELDEGDESDPARSPLEESGPGSYDDPQ
VALTLPHTTSVASALVATPIAITILQLRDDSLLRNTVYQLLEQDPAKALRSTYIRSDDYLLRPGQFKYIP
FEPIHAETRFVAVIADYRGHENASWRQVLRIPPRGRQIMLSVLVNDTHIVLKEED
 
Nucleotide Sequence: 798 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2995261-2994464 Pseudomonas putida KT2440 chromosome, complete genome
ATGAAACCTCATCCACTTCTGCTCGCCTCCCTGCTGCTTGCGCTGGTCGCGCCCACCGGCTGCACCTCTT
TGAGCAGAATGAGCCAGGTGGCCATGGACCACTCGTTGCCCATCGGGCCGCCCAAGGATCACCCGACCGA
GGTCGCATTCAGCATCAATGCCAGCCCTACCCTCAACGGCAATCCGGACAGCCTTGACGTCGCAGCCGAT
CAGGATCGCGCCCTGGAGCCCAGCCCCTACGCTGTGACCCTGAGTGCTGGCGACCCCTATGCGTTGACCG
AAAAAATCGGGGTTCTGTTCGAATACCTACAAGCGCAATTCCCGGCCATGTCCCCCGTCGAGCTGGACGA
AGGAGACGAAAGCGACCCGGCTCGCTCGCCCCTGGAAGAAAGCGGCCCCGGCAGCTACGACGACCCTCAG
GTGGCGTTGACCTTGCCGCACACCACAAGCGTTGCCTCAGCGCTGGTCGCCACGCCCATTGCCATCACGA
TCCTGCAACTGCGCGACGACTCACTGCTGCGCAACACCGTGTACCAGCTACTGGAGCAGGACCCGGCCAA
GGCGCTGCGCAGTACCTATATCCGTAGTGACGACTACCTGCTGCGCCCTGGCCAATTCAAGTACATCCCG
TTCGAACCCATCCACGCCGAAACCCGCTTCGTCGCGGTGATCGCCGACTACCGAGGCCATGAAAACGCCA
GTTGGCGGCAAGTACTGCGCATTCCGCCGCGTGGCCGCCAGATCATGCTGTCGGTGTTGGTCAACGACAC
GCACATCGTGCTCAAGGAAGAAGACTGA