SecReT6
Protein ID: 26989338
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2619
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2995258..2995827 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ88JN0
KEGG IDppu:PP_2619
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-09, Aligned region: 30..96
Protein Sequence: 189 a.a.     [Download]
>gi|26989338|ref|NP_744763.1| unnamed protein product [Pseudomonas putida KT2440]
MNTVTLSITNLDQLQHGVTARHLFDCKGGTIGSGRANWQINDRDQTVAPIHCEIRWIEGSFCVIDHCHRT
YLNGSANSLGPLPPRRLVEGDQLLIGTYRLQVQYSQDQACTRSLEDLFNPDPRVLDRLIAEAPAPAWPAQ
PSAPQPAVEICSVFKAAMGNDPLAALDAADGEGALRESPLQRLIAGAYP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2995827-2995258 Pseudomonas putida KT2440 chromosome, complete genome
ATGAACACAGTCACCTTGAGCATCACCAACCTCGACCAACTGCAGCACGGCGTTACTGCTCGGCACCTGT
TCGATTGCAAGGGCGGCACCATCGGCAGTGGGCGAGCAAACTGGCAGATCAATGACCGCGATCAGACCGT
TGCGCCCATCCACTGCGAAATCCGCTGGATCGAAGGCAGCTTCTGTGTGATCGACCACTGCCACCGTACC
TACCTCAATGGCAGTGCCAACAGCCTGGGGCCGCTTCCACCCAGACGCCTGGTTGAGGGTGACCAGCTTC
TCATTGGTACCTATCGGCTACAGGTTCAGTACTCCCAGGATCAGGCCTGCACGCGCTCGCTGGAGGACCT
GTTCAACCCGGACCCGAGGGTGCTCGACCGCCTGATAGCGGAAGCGCCTGCACCCGCTTGGCCGGCACAG
CCTTCTGCCCCCCAACCAGCCGTCGAGATCTGCTCGGTCTTCAAAGCAGCCATGGGGAATGACCCTCTGG
CAGCGCTGGACGCGGCAGACGGTGAAGGGGCACTCCGAGAAAGCCCGCTGCAGCGCCTGATTGCCGGAGC
ATACCCATGA