SecReT6
Protein ID: 26989339
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2620
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2995824..2996840 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ88JM9
KEGG IDppu:PP_2620
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-85, Aligned region: 19..321
Protein Sequence: 338 a.a.     [Download]
>gi|26989339|ref|NP_744764.1| unnamed protein product [Pseudomonas putida KT2440]
MANTDRQATADLADKLLCEAHQYNFFQLLERLHGLHGDDLEPRWPDKATRRRVRLACDPRLTFPVSDVYK
AQRMPAEEARYRIIATFLGLHGTDSPLPTYYLEQVAYEHAHGIGVRPAFFDFFNHYLLSLLHRIWRKYRY
YIRFQPGASDGFSQYVFALLGLNDKQLRGDTALPWSRLLSFAGVIASRSRAPGTVAGIIAHCFDLKQVHI
REFETRSVVTPSRQLASLGRTNGQLGSTFMIGSRTRTRSSKFTIVISELDQTQLRDLLPSGINFGRLRAL
IDFLLRDGLAYDLELRLKQSALSPFCLHRSQGAYLGWTSFVDDRHGQISPVVRIRGRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2996840-2995824 Pseudomonas putida KT2440 chromosome, complete genome
ATGGCCAATACAGACCGGCAAGCAACCGCTGATCTAGCCGACAAGTTGCTCTGCGAAGCGCACCAGTACA
ACTTCTTCCAGTTGCTGGAGCGGTTGCACGGGCTGCATGGCGATGACCTGGAACCCCGTTGGCCGGACAA
GGCCACCCGGCGGCGCGTGCGCCTGGCCTGCGACCCACGGCTGACCTTCCCTGTTTCGGACGTGTACAAA
GCCCAGCGGATGCCCGCTGAGGAAGCGCGCTACCGCATCATTGCCACATTCCTGGGGTTGCACGGCACCG
ATTCGCCATTGCCCACCTATTACCTGGAACAGGTGGCGTATGAACATGCGCATGGCATCGGTGTACGGCC
GGCCTTCTTCGACTTTTTCAACCATTACCTGCTCAGCCTGTTGCACCGTATCTGGCGCAAGTACCGCTAT
TACATCCGCTTCCAGCCAGGTGCCAGTGACGGGTTCTCGCAGTACGTGTTTGCCCTGCTGGGGCTTAACG
ACAAGCAGTTGCGAGGGGACACGGCGCTGCCCTGGAGCCGCCTGCTCAGTTTTGCCGGCGTGATCGCCAG
CCGCAGCCGAGCGCCGGGCACTGTAGCCGGCATCATTGCGCACTGCTTCGACCTCAAGCAGGTGCACATC
CGCGAGTTCGAGACGCGATCAGTCGTCACGCCGTCCAGGCAGCTTGCAAGCCTGGGGCGGACCAACGGCC
AGCTGGGCAGCACGTTCATGATTGGCAGCCGCACGCGCACCCGCAGCAGCAAGTTCACCATCGTGATCAG
CGAACTCGACCAGACGCAGCTGCGGGACTTGCTGCCCAGCGGCATCAACTTCGGCCGTTTGCGTGCACTG
ATCGACTTTCTGCTGCGTGACGGGCTGGCCTATGACCTGGAGCTGCGCCTCAAGCAGAGCGCGTTGTCAC
CCTTCTGCTTGCACCGCAGCCAGGGCGCATACCTGGGCTGGACCAGCTTCGTCGACGACCGGCATGGCCA
GATCAGCCCGGTTGTACGCATCCGGGGGCGCTCATGA