SecReT6
Protein ID: 26989340
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2621
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2996804..2998570 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ88JM8
KEGG IDppu:PP_2621
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.70E-192, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|26989340|ref|NP_744765.1| unnamed protein product [Pseudomonas putida KT2440]
MSLRDRFSEELRYLHELGNDFAKDNPQLARLLGKGASDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQLLWPNYLRPLPSATIIKFSPVRQSLSQSQRIPKGSRLFSKPVDGVACEFRTCTAVNIHPFEIDTVAAT
QTSDSSVICIGLQSLVERPLNSLGCTSLDFYLSGDARTARTLYLWVSQYLKHVSVTINGEVRRLPANSIA
FPGFSPNDALLPYPQNVFDGYRILQEYFAFPQRFHFFSVTGLEKIWPAHDSQQVNLEFHFTRQLPDSLRV
GKADFNLFCAPAVNLFQHSAEPIDLSGKDAMVPLKPKGTAPHGYEIFSVDQVISTRTTTDGNTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEECLHGNGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINILTELTPPLATYTNLCTPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRAYDFMALH
DIQQARTTRKRLEGMRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEGDLYLFSCVLAHFFALYASIN
SFHQLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2998570-2996804 Pseudomonas putida KT2440 chromosome, complete genome
ATGTCTCTGAGAGACCGTTTCAGTGAAGAACTGCGTTACCTGCACGAACTGGGGAACGACTTTGCCAAGG
ACAACCCACAACTCGCGCGGTTGCTTGGCAAAGGTGCCAGCGACCCCGATGTCGAACGCCTGATGGAAGC
CTTTGCGTTCCTGACCGCCAAGCTACGGCTGAAGCTGGAAGACGACTTGCCAGAGCTGACCCATCCCATG
CTGCAGTTGCTGTGGCCGAACTACCTGCGGCCGCTGCCCAGCGCGACGATCATCAAGTTCAGCCCGGTGA
GACAATCCCTCAGCCAGTCACAGCGCATCCCAAAGGGGTCGCGGCTGTTCTCGAAACCGGTAGACGGCGT
GGCCTGCGAGTTCCGCACCTGTACAGCGGTCAACATTCATCCGTTCGAGATCGACACGGTCGCAGCCACC
CAGACATCCGACAGTTCTGTGATCTGCATCGGCCTGCAATCACTGGTCGAGCGGCCGTTGAACAGCCTGG
GCTGTACCAGCCTCGACTTTTACCTCAGCGGCGATGCCCGAACCGCTCGCACGCTTTACCTGTGGGTTTC
TCAATACCTCAAGCATGTCAGCGTGACCATCAACGGCGAGGTTCGTCGGCTGCCGGCAAACAGCATCGCT
TTCCCAGGGTTCAGCCCCAACGACGCCTTGCTGCCTTACCCACAGAACGTCTTTGATGGCTATCGCATCC
TGCAGGAGTACTTCGCGTTCCCTCAACGCTTCCACTTTTTCAGCGTTACCGGCCTGGAAAAAATCTGGCC
AGCTCATGACAGCCAGCAGGTAAACCTCGAATTTCACTTCACGCGCCAGCTACCCGACTCGCTGCGTGTC
GGCAAAGCAGATTTCAACCTGTTCTGCGCACCTGCGGTCAACCTGTTCCAGCACAGCGCCGAGCCCATCG
ACCTGTCCGGCAAGGACGCCATGGTTCCACTGAAGCCCAAGGGCACAGCGCCGCACGGCTACGAAATCTT
CAGTGTCGACCAGGTGATCAGCACCCGAACGACGACTGACGGTAACACCGGTGAGCACCTTCGGACCTTC
CGTCCCTTCGAGTCCTTCGCCCATGAAATCGAGCACGTCCAGGGGCGCACGGCGCTGTATTACCGCTGCC
AGCTGGAAGAGTGCCTGCACGGCAATGGCGTCATGCATCGAATCGCCTTCGTCCGCGCCGACGCCAACAG
CTACATAGGCGAGCTGGAAACCGCGTCCATCGACCTCACCTGCACCAATCGGGACCTCCCGCTGGCGCTG
GGCATTGATGACATCAACATTCTGACCGAACTTACGCCGCCTCTGGCCACCTACACCAATCTCTGTACAC
CCACCCGCCCCTGTCGCCCGGTGCTGGACGGCCAGTTGCAGTGGGCATTGATCTCCAACATGTCGCTCAA
CTACCTGTCCTTGCTCTCGGTAGAGCCGCTGAAAGCGGTGATCCGCGCCTACGACTTCATGGCCCTGCAC
GACATCCAGCAGGCACGCACCACCCGTAAACGCCTGGAAGGTATGCGCGACATTCATACGCAGCCCATGG
ATTGGCTGATCAAGGGGCAACCCATTCGCGGCCTGCACACCCGGCTGAAACTGGACCAGACCGCCTTCCT
CTGCGAAGGCGACTTGTACCTGTTCAGCTGTGTGCTCGCTCATTTCTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCACCAGCTGGAAGTGATCAACACCACCAATAACGAGCATTACACATGGCCAATACAGACCGGCA
AGCAACCGCTGATCTAG