SecReT6
Protein ID: 26989341
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2622
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2998574..2998984 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ88JM7
KEGG IDppu:PP_2622
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.40E-21, Aligned region: 25..119
XLF [PF09302], Evalue: 0.0033, Aligned region: 6..90
Protein Sequence: 136 a.a.     [Download]
>gi|26989341|ref|NP_744766.1| unnamed protein product [Pseudomonas putida KT2440]
MSGLFDRLMVDQCTRREASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDVSNGDLLVQ
VSADIRRTLQRFEPRIQVRTLNAVPDTHAPLELHFRLDCLVQVNNHAEQLQLELLVDGHNRYTRVR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2998984-2998574 Pseudomonas putida KT2440 chromosome, complete genome
ATGAGTGGTCTTTTTGATCGCCTGATGGTGGACCAGTGCACCCGCCGAGAGGCCTCCCGACGGGAGAGCG
CTTCCCACAAGTTCGCCGCCATCAAGCGCCACCTCGAAACGCTGCTGAATGCCCGCCAGGGGTGCTCCCA
GAGCAGCCCTGAGCTGGGCCTGCGCGACTTCAATGGGCATGACGTGAGCAACGGCGACTTGCTTGTGCAG
GTGAGCGCGGATATCCGCCGCACCCTCCAGCGCTTCGAGCCGCGCATACAGGTACGCACGCTCAACGCAG
TGCCCGATACCCATGCCCCGCTGGAGCTGCATTTCAGGCTGGATTGCCTGGTACAGGTCAACAACCACGC
AGAACAGCTGCAACTCGAGCTGCTGGTCGATGGGCACAACCGCTACACGCGCGTGAGGTGA