SecReT6
Protein ID: 26989342
SecReT6 ID13
T6SS typei1
Gene symbol-
Locus tagPP_2623
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2998981..3000471 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ88JM6
KEGG IDppu:PP_2623
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.90E-185, Aligned region: 70..494
Protein Sequence: 496 a.a.     [Download]
>gi|26989342|ref|NP_744767.1| unnamed protein product [Pseudomonas putida KT2440]
MPKPSSTAITTDATADTLSNTTLLDQIMAETKLVPAQEGYQIARQGVSAFITEILKSNDPDQLINKHRAD
QMIAEIDRMLGKQMDAILHQPEFQQLESSWRSLKLLVDRTDFRENIKLEILHVSKEDLLDDFENAADVTC
SGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFLAAPAPEFFNLNSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEQPIESFNYNEDIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKHFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
RDLESELNKWIKQYVADQENPSADVRSRRPLRAARIEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c3000471-2998981 Pseudomonas putida KT2440 chromosome, complete genome
ATGCCCAAGCCAAGCAGCACCGCCATCACCACAGACGCAACGGCCGACACATTGAGCAATACCACCCTGC
TCGACCAGATCATGGCAGAAACCAAACTGGTACCTGCCCAGGAGGGCTACCAGATTGCCAGGCAGGGCGT
ATCTGCCTTCATCACCGAAATCCTCAAGAGCAATGATCCAGATCAGCTGATCAACAAGCACCGAGCCGAC
CAGATGATTGCCGAGATCGACCGAATGCTCGGCAAACAGATGGATGCCATTCTGCATCAGCCTGAGTTCC
AGCAGCTTGAATCATCATGGCGCAGCCTGAAACTTCTGGTCGACCGCACGGACTTCAGGGAGAACATCAA
GCTTGAAATCTTGCATGTCAGTAAAGAGGACCTGCTCGACGACTTCGAAAATGCTGCTGACGTTACCTGC
AGCGGTATCTACAAGCATGTTTACACCGCGGGTTATGGCCAATTCGGGGGAGAGCCGGTTGCGGCCATGG
TAGGCAACTACAACTTCGGCCCCTCTTCCCCTGACATCAAGTTGCTAAGTTACATGGCCTCCGTTGGCGC
CATGTCCCATGCCCCTTTTCTTGCTGCACCTGCCCCCGAATTCTTCAATTTGAACAGCTTCGAGGAGCTG
CCTAACCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCATGCCAAGTGGCGCGCTTTTCGTGAAA
GCGAAGACGCCCGCCACGTCGCCCTGACCGGGCCGCGCTTCATGCTTCGCTCCGCTTACCACCCGCAGGA
ACAACCGATCGAGAGCTTCAACTACAACGAAGACATCGCCGGGCAGCACGACAACTACCTGTGGGGCAAT
TCTGCTTTTCTGTTAGCCAGTTGCATCAACGACAGCTTCGCCCGCTACCGCTGGTGCCCGAACATCATCG
GCCCCCAATCCGGCGGTGCTGTCGAAGACTTGCCGGTCCATCTGTACGAATCCCTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTGCTGATATCCGACCGCAAGGAATTCGAACTGGCCGAAGAGGGCTTCATCGCC
CTGACCATGCGTAAAGACAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTACAAAAGCCCAAGCACT
TCCCGAAAACCCCTGAGGGGCTTCAGGCACAGACCAACTACAAGCTGGGTACCCAGTTGCCCTACCTGTT
CATCGTCAACCGGCTCGCCCACTACATCAAGGTGCTGCAGCGCGAGCAGATCGGCAGTTGGAAAGAGCGC
CGTGACCTTGAGTCCGAGCTGAACAAATGGATCAAGCAGTACGTCGCCGACCAGGAGAACCCGTCTGCCG
ACGTTCGCAGCCGCCGGCCGCTGCGTGCCGCCCGTATTGAGGTCTCGGATGTTGCGGGTGACCCGGGCTG
GTACCAGGTTTCGCTCGCCGTACGCCCGCACTTCAAGTACATGGGCGCGAACTTCGAGATTTCCCTGGTC
GGGCGGCTCGATACGCAATGA