SecReT6
Protein ID: 271499852
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1290
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1438517..1439020 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDD2BVL8
KEGG IDddc:Dd586_1290
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|271499852|ref|YP_003332877.1| type VI secretion protein, VC_A0107 family [Dickeya dadantii Ech586]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMVVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEDSQDDLPVKLSIASLNDFSPDRIAQQVPELRKLLELREALVALKGPLGNIPAFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1438517-1439020 Dickeya dadantii Ech586 chromosome, complete genome
ATGGCAAAAGGAACTGACGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTCCCGGCCA
CTGGTGGTCAGCAGGCGGAAATTGAACTTCCGCTCACGTTGATGGTGGTGGGAAATATGAAAGGACGCAC
AGAAGAGACGCCGATTGAAGAACGTCAGACGGTGTCTATCGATAAGAATAATTTCACTTCGGTCATGAAA
GAGGCCAACCTGGAGCTGAATTTCAGCGTACCTAATCGTCTGGAAGAAGACAGCCAGGATGACCTTCCCG
TCAAACTCAGCATTGCTTCGCTGAATGATTTCTCTCCCGATCGTATCGCACAGCAAGTGCCGGAACTGCG
CAAATTGCTGGAATTGCGAGAAGCACTGGTCGCCTTGAAAGGGCCGCTGGGTAATATTCCCGCTTTCCGT
AATCGCCTGCAGGACCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTGCTCAAAGAGCTGGATCTGGTGA
AACCCGCCGAATAA