SecReT6
Protein ID: 271499853
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1291
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1439052..1440530 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDD2BVL9
KEGG IDddc:Dd586_1291
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-187, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|271499853|ref|YP_003332878.1| type VI secretion protein, EvpB/VC_A0108 family [Dickeya dadantii Ech586]
MSMVEEQAQTSAAGGSSSLLEEIMAQARITPVDEGYNVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAQELQELESSWRSLKLLIDRTDFRENIKILLLHATKDELLEDFEFAPEITQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDSFTDLPSIK
DLKSVFEGPTYTKWRSMRESEDARYLGLTAPRFLARLPYDPVENPIKGFNYKEDISASHENYLWGNTAYL
MGTAITDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFANTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNNWIKQYVADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMAVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1439052-1440530 Dickeya dadantii Ech586 chromosome, complete genome
ATGTCAATGGTTGAAGAACAGGCCCAGACAAGCGCGGCCGGTGGTTCATCATCGCTGCTTGAAGAGATCA
TGGCGCAGGCGCGCATTACCCCGGTGGATGAAGGTTATAACGTCGCCAAACAGGGTATTGCCGCACTGGT
GGCAAACATTCTGGATAGCGGCAACGCAGCCGAGCCGGTGAACAAAGCGCTGGTCGACAGCATGATCGTT
GAGCTGGACAAAAAACTCAGCAAACAAATCGACGTGATTCTGCATGCTCAGGAGCTACAGGAACTGGAAT
CCTCCTGGCGTTCACTGAAGCTGCTGATTGATCGCACCGATTTCCGTGAAAACATCAAAATCCTGCTGCT
GCACGCGACCAAAGACGAGCTGCTGGAAGACTTTGAGTTTGCACCGGAAATTACCCAATCCGGTTTCTAT
AAACACGTGTATTCCAGCGGCTACGGCCAGTTCGGTGGCCAGCCGATCGGCGGGGTGATTGGCGATTATG
CGCTGACCCAAAGCTCGCCGGACATCAAGCTGATGCAGTATGTCAGCGCGGTAGGTGCGATGGCGCATGC
TCCGTTTATCTCCTCCGTTGCACCGACTTTCTTCGGTGTAGACAGCTTTACCGACCTGCCGTCGATCAAA
GACCTGAAGTCGGTGTTTGAAGGCCCGACCTATACCAAATGGCGCTCAATGCGTGAGTCGGAAGATGCCC
GTTATCTGGGGCTGACAGCGCCGCGTTTCCTGGCCCGTTTGCCGTATGACCCGGTAGAAAACCCCATCAA
AGGGTTTAACTACAAGGAAGACATCAGCGCCAGTCACGAAAACTATTTGTGGGGCAACACCGCGTATCTG
ATGGGCACCGCCATTACCGATAGCTTCGCCAAGTACCGCTGGTGCCCGAACATTATCGGCCCGCAGAGCG
GCGGCGCTATTACCGATCTGCCGGTGCATGTGTATGAAGCGATGGGCCAGTTGCAGGCCAAGATCCCGAC
CGAGGTGTTGATCACCGACCGTCGTGAATACGAAATGGCCGAAGAAGGTTTCATCACGCTGACCATGCGC
AAAGACAGCGATAACGCGGCGTTTTTCTCTGCCAACTCGGTGCAGAAACCCAAGGTGTTCGCCAATACCA
AAGAAGGTAAAGAGGCGGAAACCAACTACAAACTGGGTACGCAGCTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTGTTGCAGCGCGAGCAGATCGGTTCCTGGAAAGAGCGTCAGGATCTGGAG
CGCGAGCTGAATAACTGGATCAAGCAGTACGTTGCTGATCAGGAAAACCCGCCAGCTGATGTCCGCAGCC
GTCGTCCGCTGCGTGCGGCACAAATCAAAGTGCTGGACGTGGAAGGCGAACCGGGCTGGTACCAGGTGAC
CATGGCAGTGCGTCCACACTTCAAGTACATGGGGGCGAACTTTGAACTGTCCCTGGTTGGTCGTCTGGAT
AAGGAATAA