SecReT6
Protein ID: 271499854
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1292
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1440537..1440968 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD2BVM0
KEGG IDddc:Dd586_1292
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-20, Aligned region: 31..123
Protein Sequence: 143 a.a.     [Download]
>gi|271499854|ref|YP_003332879.1| type VI secretion system lysozyme-like protein [Dickeya dadantii Ech586]
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIASVKRQLDQVLNTRPGSCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVRLEELEQVTSFNIHMDSHRHY
RMM
 
Nucleotide Sequence: 432 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1440537-1440968 Dickeya dadantii Ech586 chromosome, complete genome
ATGCCGTCGCTCTCTGCCTGGGAGCGGGGATCTGCGGCCAGCCTGTTTGATCGCATCCGGGGAGAGGAGC
GTCGCTCCTCCCCCGAAACGGAATTAGAAGACTTGATCGCGTCGGTGAAACGCCAGCTTGATCAAGTGCT
GAATACGCGTCCCGGCAGTTGTCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCTACGCAG
GGCGGCGCGGATATCCGGGGCAAAATCCGTGAGGCGATCCGGCAGTGTATCTGTCGCTTTGAACCGCGCA
TTGTCCATGTGGACGTCAGTGCATCGGACTATCTGTCCAATCCGCTGGAGATGTCGTTTCAGGTCACCGC
CCATGTGCGGCTGGAAGAACTGGAACAGGTCACCTCCTTCAATATTCATATGGACAGCCACCGCCATTAC
AGAATGATGTGA