SecReT6
Protein ID: 271499855
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1293
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1440971..1442737 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDD2BVM1
KEGG IDddc:Dd586_1293
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-199, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|271499855|ref|YP_003332880.1| type VI secretion protein, VC_A0110 family [Dickeya dadantii Ech586]
MSLEHFFRDELAYLRLQGREFANAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVARGCELDSLPIDDVVCHFQTCHDAWIYPADIRQINAQ
SGNDMSAITLDIGLHGPVALGDLQLDKLRFFLGGDRYTAYELYFWIASQLSHIELEVDGKRFRQEASVLK
TVGFEREDAMLPYPGNVYSGYRILQEYFCFPESFLFFQLSGASWPDQPLMVTDFKLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFRHDSEPINLDGRQTDYPLKASYRHADSFEIFSIDKVEGWVEGNSGRARGIPRLY
QPFESFQHQIERAKGRLALYYRIRVREAVNGDGFDHLLSFVRGDEKEVIDLDESISVSLTCTNRSRAAQL
PVGAICVPTGSSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIETIETTPVDRLVQGMPVRGLKSVLSVRQSAFASEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1440971-1442737 Dickeya dadantii Ech586 chromosome, complete genome
ATGTCGCTGGAACATTTCTTCAGGGATGAACTCGCTTATTTGCGTCTGCAAGGACGTGAATTTGCCAATG
CACACCCTGAACTTACCCGATTTTTGTCAGAACAGACCACGGATCCGGATGTCGAGCGATTGCTGGAAGG
GTTCGCCTTTCTGACGGGTAGCCTGCGGGCGAAGATCGAGGATGAATTTCCGGAGCTGACTCACGGCCTG
CTGGGCATGCTGTGGCCGAACTATTTGCGCCCGGTACCCAGCATGACCATCATGCAATTTTCGGTGCTGC
CCGGTGCTATCGCGCAACCGGCGTTTGTAGCGCGTGGCTGCGAGCTGGACAGCCTGCCAATAGACGATGT
GGTCTGCCATTTCCAAACCTGCCACGACGCCTGGATCTACCCGGCGGATATCCGCCAGATCAACGCGCAA
AGCGGCAACGACATGTCCGCCATCACGCTGGATATTGGTCTGCACGGGCCGGTGGCGCTGGGGGATTTGC
AGCTGGATAAACTGCGCTTCTTCCTGGGTGGCGACCGCTATACTGCCTACGAACTCTATTTCTGGATAGC
CAGCCAGCTGTCACACATTGAGCTGGAAGTGGACGGGAAACGCTTTCGTCAGGAGGCGAGTGTACTCAAA
ACCGTCGGCTTTGAGCGTGAAGACGCGATGCTGCCGTATCCCGGTAATGTGTATTCCGGCTACCGTATCC
TTCAGGAGTATTTCTGTTTTCCGGAAAGTTTCCTGTTCTTTCAGTTGTCCGGTGCCAGTTGGCCTGATCA
GCCGCTGATGGTGACGGATTTCAAACTGCATTTCTGCTTTGACCGGCCGCTGCCGGCGGAACTGAAAATC
CGCCCGGATTCGTTCATGCTCAATTGTGTACCGGCTATCAACCTGTTCCGCCATGACAGCGAACCGATCA
ACCTGGATGGTCGCCAGACGGACTACCCGTTGAAAGCCAGCTACCGCCACGCCGACAGCTTCGAGATTTT
CTCCATCGATAAAGTGGAGGGGTGGGTGGAAGGTAACAGTGGACGCGCGCGCGGTATCCCACGGCTTTAC
CAACCTTTCGAGAGTTTTCAGCACCAAATCGAGCGGGCCAAAGGTCGACTGGCGCTGTATTACCGCATTC
GGGTGCGCGAAGCCGTCAATGGTGATGGTTTCGATCACTTATTGTCGTTCGTGCGGGGCGACGAAAAAGA
AGTCATCGACCTGGACGAGTCCATTTCGGTGAGCCTGACCTGCACCAACCGTTCGCGGGCGGCGCAGTTG
CCTGTGGGGGCGATTTGCGTGCCGACCGGCAGTTCACCGTCCTTTGCCACCTTCCGTAACCTGATTCGGC
CGACCCGTCCATTGCGCCCGGCACTCGATGGCAGCCTGCACTGGACGCTTATCTCCAACCTGTCATTGAA
CTATGTGTCGCTGCTGCGACGCGATGCGCTGGTGCAGATCCTGCGTACTTACGACTTCCCGGCACTGCAT
GACAAGCAGGCCGAGCAGGCATCGCGTAAACGGCTGGCGGGGATAGAAACGATCGAGACCACACCGGTAG
ACCGGCTGGTACAGGGGATGCCGGTACGCGGGCTCAAGTCAGTTCTCTCCGTGCGGCAGTCGGCGTTCGC
CAGTGAAGGCGAGCTCTATCTGTTCAGCACTGTGCTGGCGCATTTCTTCTCGTTGTATGCCAGCGTTAAC
GCCTTCCACCTGCTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTGCAGATAGGTC
AGCACTCGATGATGTGA