SecReT6
Protein ID: 271499856
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1294
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1442701..1443714 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDD2BVM2
KEGG IDddc:Dd586_1294
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.40E-95, Aligned region: 21..324
Protein Sequence: 337 a.a.     [Download]
>gi|271499856|ref|YP_003332881.1| type VI secretion protein, VC_A0111 family [Dickeya dadantii Ech586]
MAGADRSALDDVTAGQAMFRQDARHFNFFQLVELLNQMEGVDLEQALDFRPELERIRFRSTASIGFHPSD
VLRVGEDTDGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYR
YHVRFQNDGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGLLASPSRSPEVVAGLVIHCFDLEDVE
VIAWQHRKVPIFEDQQNRLGRANSLLGGDFVIGDKVNDCAGKFLLKVDNLSFSRFLSFLPNGEHFQPLVR
FVSFILRDQLAWDLRLGFAEGEARGLRLGDDQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1442701-1443714 Dickeya dadantii Ech586 chromosome, complete genome
ATGGCCGGTGCAGATAGGTCAGCACTCGATGATGTGACCGCAGGGCAGGCGATGTTTCGCCAGGATGCGC
GCCACTTCAACTTTTTCCAACTGGTGGAGTTACTCAACCAGATGGAAGGCGTCGATCTGGAGCAGGCGCT
CGACTTCCGGCCAGAACTGGAGCGCATTCGCTTTCGCTCCACCGCCTCGATTGGCTTTCACCCCAGTGAT
GTTCTGCGGGTAGGGGAAGATACCGACGGCAGGCAGGAGCTGGAAGTGGCGTTCCTCGGGCTGCACGGCA
GCCAGTCGCCGATGCCGGGGTACTACCTTGAAGAGCTGGCGTGGGAATACGCCCAGGGCGAGCAGAAACT
GGGGGTGTTCCTCGATTTCTTTCATCACCGCTTGCTGACGCTATTGCACCGTGCCTGGCGTAAGTACCGC
TATCACGTGCGTTTCCAGAATGATGGCGAGGATGGCTTCTCCCGGCTGATGTTCGCGCTGGTGGGGCTGG
GTAACGACGCGGTGCGCGACAGTCTGCCGGTCAACCGCGCCAAGATGCTGTCTTACGCCGGTCTGCTGGC
CAGCCCCAGCCGCTCGCCGGAAGTGGTGGCTGGTCTGGTGATCCACTGCTTTGACCTGGAAGACGTCGAA
GTCATCGCCTGGCAACACCGCAAAGTACCGATTTTTGAAGACCAGCAAAACCGCCTTGGGCGCGCGAATA
GCCTGCTGGGTGGGGATTTTGTCATCGGCGACAAAGTAAACGACTGTGCCGGTAAATTCCTGCTCAAGGT
GGATAACCTCAGCTTTAGCCGTTTTCTCAGTTTCCTGCCCAACGGCGAACATTTTCAGCCGCTGGTGCGT
TTTGTTTCCTTCATTTTGCGTGATCAACTGGCCTGGGACTTACGCCTCGGTTTCGCCGAAGGGGAGGCCA
GAGGGCTAAGACTGGGCGATGACCAGAGCAGCCGTCTGGGATGGAGCAGCTTTCTCGGGCAGCCGCCCGC
CGACCCGTATGTGACGATTTGTGTGCAGGAGTAA