SecReT6
Protein ID: 271499857
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1295
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1443717..1444931 [+]
ProductFHA domain containing protein
NoteFha
UniProt IDD2BVM3
KEGG IDddc:Dd586_1295
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-06, Aligned region: 33..100
Protein Sequence: 404 a.a.     [Download]
>gi|271499857|ref|YP_003332882.1| FHA domain containing protein [Dickeya dadantii Ech586]
MNENNPLTLVVLNSEQLDINSQVQHRFDHRGGTLGASEKDQWQLRDRLGAVLPEHARIELQDGYFCVCDL
SGQTFINGALSPIGRDRRVRLAQGDELVIGPFRLGVYLDDPAFEQDIDQVLGQRPGDVLEGWLGEEQRRA
PADDTAADRFNDPLWALQQEQSRSLLATEAERGDELPTSLSSFSAVEDTMDQKFVELPTIDNPHTGTAFG
ASVDAVTLAPLLRGLGVSLNTGDEQQLREMLEEMGKSLKAMVEGLLTLQADQAALADTHLRPIEDNPLRL
GLDYTDTLSLLFADDKSPVHLSAPAAISEVLSNMQAHHRANQQAIAVALESILQAFSPAALLGRFEHYRR
SGERQALDDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1443717-1444931 Dickeya dadantii Ech586 chromosome, complete genome
GTGAACGAAAACAACCCACTCACTCTGGTGGTGCTCAACAGCGAACAACTGGATATCAACTCGCAGGTGC
AACACCGCTTTGACCACCGTGGCGGCACGCTGGGCGCATCGGAAAAAGATCAATGGCAGTTGCGCGACCG
GCTCGGCGCAGTTTTGCCGGAGCATGCACGTATCGAATTACAGGATGGCTATTTCTGCGTCTGCGACTTG
AGTGGCCAGACCTTCATCAATGGCGCGTTGTCGCCCATCGGTCGTGATCGCCGGGTGCGTTTGGCGCAGG
GTGACGAACTGGTGATTGGCCCATTCCGGCTTGGGGTTTACCTCGACGATCCCGCTTTCGAGCAGGATAT
CGATCAGGTGCTGGGGCAACGCCCCGGTGATGTGCTGGAAGGGTGGCTTGGGGAAGAACAACGCCGTGCG
CCCGCCGATGACACGGCGGCGGACCGATTTAATGACCCGTTGTGGGCGCTGCAGCAGGAACAGAGCCGCT
CGCTACTGGCAACGGAGGCTGAGCGCGGTGATGAACTGCCGACCTCGCTTTCTTCTTTTTCTGCCGTTGA
GGACACCATGGATCAGAAATTTGTGGAATTACCGACCATTGACAATCCGCATACCGGTACCGCGTTTGGC
GCATCGGTGGATGCGGTGACGCTGGCACCGCTGTTGCGCGGGCTGGGCGTATCACTCAATACCGGCGATG
AGCAACAACTGCGCGAGATGCTCGAAGAGATGGGCAAAAGCCTCAAAGCGATGGTGGAAGGCTTGCTGAC
GTTGCAGGCCGATCAGGCAGCGCTGGCGGATACCCATTTGCGGCCAATCGAAGATAACCCGTTGCGTCTG
GGGCTGGATTACACCGACACCCTGTCGCTGCTGTTCGCCGACGATAAAAGCCCGGTGCACCTGTCCGCCC
CGGCGGCTATCAGCGAAGTGCTGAGTAATATGCAGGCGCATCACCGGGCTAACCAGCAGGCGATCGCCGT
GGCGCTGGAGAGCATTTTACAGGCGTTTTCACCGGCGGCGCTGCTGGGGCGTTTCGAGCATTATCGCCGC
AGCGGCGAGCGTCAGGCGCTGGATGACGGTTGGGCGTGGCAGATGTATCAGCACTATTACCGCGAACTGA
CCTCACCGCGTCAGCAAGGGTTCCAGAAACTTTTCCATCAGGTGTATGCACAGGCGTATGACCGCGCCGT
TCGTCAGCAACAGGAGCAGAAATAA