SecReT6
Protein ID: 271499858
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1296
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1444931..1445467 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDD2BVM4
KEGG IDddc:Dd586_1296
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.00E-36, Aligned region: 16..169
Protein Sequence: 178 a.a.     [Download]
>gi|271499858|ref|YP_003332883.1| type VI secretion lipoprotein, VC_A0113 family [Dickeya dadantii Ech586]
MLRALMLRTGWLCVLMLLLPGCTTLGKMAKVAANPDIQIGSNDNQPSTVGFSLLAEPDVNPSESGDAAPI
EFQVVMLAEDSRLLATDYDQVTGDIEKALAKNYVSHQDYTLLPGQFKYLPPVKLDEKVHYIGVIAKYADP
DSAEWRKVIKLKNTGRTYQLLVHLRREEVEIKKDQEEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1444931-1445467 Dickeya dadantii Ech586 chromosome, complete genome
ATGCTGCGAGCCTTAATGCTGCGAACCGGGTGGTTATGCGTCCTGATGCTGCTGCTTCCCGGTTGTACCA
CGCTCGGCAAAATGGCGAAGGTGGCGGCCAATCCGGACATTCAGATTGGCAGCAATGATAACCAGCCTTC
GACCGTCGGCTTTAGCCTGCTGGCCGAGCCGGACGTTAACCCCAGTGAGAGCGGCGACGCGGCACCCATC
GAGTTTCAGGTGGTGATGCTGGCGGAAGACTCCCGCCTGCTGGCGACCGACTATGACCAGGTGACCGGCG
ACATCGAAAAAGCGCTGGCTAAAAACTACGTCAGCCACCAGGACTACACGCTGCTGCCAGGGCAGTTCAA
ATACCTGCCGCCGGTCAAACTGGACGAGAAAGTGCATTACATCGGGGTGATTGCCAAATACGCCGACCCG
GACAGCGCCGAGTGGCGCAAGGTTATCAAACTGAAAAACACCGGCCGCACTTATCAGCTTCTGGTGCATC
TGCGCCGTGAAGAAGTCGAAATCAAGAAAGATCAAGAAGAAGAATAA