SecReT6
Protein ID: 271499859
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1297
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1445470..1446807 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDD2BW09
KEGG IDddc:Dd586_1297
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-158, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|271499859|ref|YP_003332884.1| type VI secretion protein, VC_A0114 family [Dickeya dadantii Ech586]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRIALVNATGVMP
DGTVFNIPGDDALPQPLEITDVALANQKVYLALPLAVNGVSEVGQAGAGIATRLQSHRHDVRDLHSEGGD
VVSVEVGKVSLRLMLERDDRSAYASLAIANILDKRPDGGLVLDPNFMPCSISVTAIPSLKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDES
RLPPEFPAYRHEHQQSSFEPLMMALRQALSTVLSPRAVSIQMKAQPYGVRVALVGDAELMASAEFVLAVR
ARMPQEHLRKQLLQQTKIASSDKIRELISLQLPGVPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWKSLVT
SNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1445470-1446807 Dickeya dadantii Ech586 chromosome, complete genome
ATGTCGAGCCGAAATCGGATTATTTGGCGGGAAGGGCTGTTCATCAAGCCGCAGCATTTCCAGCAACAGC
AACGACACACCGACTACGCGCTGCACGCCCGTCTTAGCGCGCTCAGTGATTATTTCTACGGCCTGCAATC
GCTGGCTATTAACGAAGAATACCTTAACTTCGGGCGTATCGCGCTGGTGAACGCCACCGGCGTGATGCCG
GATGGCACGGTCTTCAATATCCCAGGGGATGACGCGCTGCCGCAACCGCTGGAGATTACCGATGTGGCGC
TGGCGAACCAAAAGGTCTATCTGGCGCTGCCGTTGGCGGTGAACGGTGTGAGCGAAGTCGGGCAGGCCGG
TGCCGGTATTGCCACCCGGTTGCAGTCGCACCGGCATGATGTGCGTGACTTGCACAGCGAAGGTGGTGAC
GTGGTATCGGTGGAAGTGGGCAAGGTCAGTCTGCGGCTGATGCTGGAGCGTGATGACCGTAGTGCCTACG
CGTCGCTGGCGATCGCCAACATCCTCGACAAACGGCCGGACGGTGGGCTGGTTCTTGACCCTAACTTTAT
GCCGTGCAGCATCAGCGTCACGGCGATTCCGAGCCTGAAACGCTTTCTGGGGGAATCGGCCGGTCTGGTG
GCAGAACGCGCCCGCAGTCTGGCTCAGCGTATCGCCGCGCCCGGTCAGCAAGGGGTGGCGGATGTGGCGG
AATTCATGATGCTGCAACTGCTTAACCGCGCCCAGCCGCAACTGTCGCATCTGGCGCGCCTCGGCACGTT
ACACCCGGAGCGGCTGCATGAAGCGCTGGTGCAACTGTGCGGTGAGCTGATGACCTTTACCGATGAATCG
CGCCTGCCGCCGGAGTTTCCCGCTTATCGTCATGAGCATCAGCAATCGAGCTTTGAGCCGCTGATGATGG
CGCTACGTCAGGCGTTGAGTACCGTGCTGTCGCCACGTGCGGTGTCGATTCAGATGAAGGCACAGCCTTA
CGGCGTCAGGGTGGCGCTGGTGGGCGATGCCGAACTGATGGCCAGTGCCGAATTTGTGCTGGCGGTGCGC
GCCCGTATGCCGCAAGAACATTTGCGCAAGCAACTGCTGCAACAAACCAAGATCGCCTCCAGCGACAAAA
TCCGCGAGCTCATCAGTCTGCAACTGCCTGGCGTACCGTTGCTGCCGCTACCGGTGGCACCGCGTCAGTT
GCCGTACCACGCCGGTTACAGCTACTTCCAGTTGGACAGGCAAAGCCCGGCCTGGAAATCGCTGGTCACC
AGCAACACGCTGGCGTTCCACATCGCTGGCGAGTTCCCGGAACTGGATATGCAACTGTGGGCCATCCGCG
GCCAGTAG