SecReT6
Protein ID: 271499860
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1298
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1446824..1447600 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDD2BW10
KEGG IDddc:Dd586_1298
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.40E-72, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|271499860|ref|YP_003332885.1| type IV / VI secretion system protein, DotU family [Dickeya dadantii Ech586]
MSTDIIKNDQLGDLLYDNARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSEYDGVAELYQRV
QSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSVWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPVRYRDILEFIYLCLCLGFEGRYRVMTQGREELDRVVRRLHDTLRPEPENSPTVFHLNLGQQSS
RYHLRKQISLRALFLGLCVVMAVAFGLYHYQLTNQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1446824-1447600 Dickeya dadantii Ech586 chromosome, complete genome
GTGAGTACCGACATCATTAAAAATGACCAGTTAGGCGACCTGCTGTATGACAACGCCCGGCAACTGGATA
TGGATTCCGATTACTGGTTCCGCCTGCGCGGGCAGAGCATCAACCCGATGATCGATGCTGTGACCCCGCT
GCTGGGCATGGTGGAGCGGGTGCGCCAGCTGTCTGAATACGATGGCGTGGCGGAGCTGTACCAGCGGGTG
CAGTCCGAAATTCAGGCCATCGAGCAGGAACTGCATTCCCACGGTTACGAAAACGGCGTGATCCTGTCGT
TTCGCTACATTCTGTGCACGTTTATCGATGAAGCGGTGATGGGACGGGAGTGGGGAGGCCAGAGCGTGTG
GTCGGCCCATTCGCTGCTGACCCGTTTTCACAATGAAACCTGGGGTGGCGAGAAGGTGTTCGTGCTGCTG
GAAAAACTGCTGGATGACCCGGTGCGTTATCGCGACATTCTGGAGTTTATCTACCTGTGCTTGTGCCTTG
GCTTTGAGGGCCGTTACCGGGTGATGACGCAAGGGCGAGAAGAGCTGGACCGGGTGGTGCGCCGCTTGCA
TGACACCCTGCGACCAGAGCCGGAAAACTCGCCGACGGTGTTTCACCTCAATCTGGGACAGCAATCTTCC
CGTTACCACCTGCGTAAACAGATTTCGCTGCGCGCCTTGTTCCTCGGCCTGTGCGTGGTGATGGCGGTGG
CGTTTGGCCTGTATCACTACCAGCTAACCAACCAGACCCAGGACGTACTGCGTCAACTGGGCGAATTATT
ACAATAA