SecReT6
Protein ID: 271499861
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1299
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1447616..1450216 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD2BW11
KEGG IDddc:Dd586_1299
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 278..326
AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 603..764
AAA [PF00004], Evalue: 4.90E-19, Aligned region: 220..332
AAA [PF00004], Evalue: 4.90E-19, Aligned region: 538..586
AAA [PF00004], Evalue: 4.90E-19, Aligned region: 609..727
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 608..728
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 132..156
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 770..843
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 135..158
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 258..298
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 368..483
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 582..647
AAA_16 [PF13191], Evalue: 2.40E-11, Aligned region: 674..702
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 219..310
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 607..626
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 670..702
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 220..245
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 413..450
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 609..633
NACHT [PF05729], Evalue: 2.60E-05, Aligned region: 813..838
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 185..237
DUF258 [PF03193], Evalue: 0.00012, Aligned region: 609..624
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 272..354
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 609..646
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 679..690
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 215..237
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 606..630
AAA_19 [PF13245], Evalue: 0.00089, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00089, Aligned region: 362..397
AAA_19 [PF13245], Evalue: 0.00089, Aligned region: 531..550
AAA_19 [PF13245], Evalue: 0.00089, Aligned region: 602..626
AAA_19 [PF13245], Evalue: 0.00089, Aligned region: 803..825
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 273..306
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 430..469
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 603..637
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 774..804
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 220..267
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 609..643
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 608..619
Sigma54_activat [PF00158], Evalue: 0.0056, Aligned region: 218..234
Sigma54_activat [PF00158], Evalue: 0.0056, Aligned region: 608..706
MobB [PF03205], Evalue: 0.0076, Aligned region: 220..241
MobB [PF03205], Evalue: 0.0076, Aligned region: 608..629
Zeta_toxin [PF06414], Evalue: 0.0084, Aligned region: 217..237
Zeta_toxin [PF06414], Evalue: 0.0084, Aligned region: 607..648
Ras [PF00071], Evalue: 0.009, Aligned region: 220..233
Ras [PF00071], Evalue: 0.009, Aligned region: 609..650
Protein Sequence: 866 a.a.     [Download]
>gi|271499861|ref|YP_003332886.1| type VI secretion ATPase, ClpV1 family [Dickeya dadantii Ech586]
MIRIELPILVERLNPLCRHMMEEAAALCIQHQGAEIRIEHLLLKMLETPLCDVRQILKRAGVEADELAAL
LQPNAADKGFESGYPSFSPLLVEWLQDSWLLASAELQHARLRSGVLLLVLLMTPTRYLTAAVTRQLAQIN
RELLRQQFDEWVKDSAETEVVTAAGVAPEQAATATTQLSRYTQNVTESARQGKLDPVLCRDHEIDLMIDI
LSRRRKNNPIVVGEAGVGKSALIEGLALRIVAGLVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVM
QEVKEAPKPIVLFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRF
QLVKVGEPNVEQATVILRGLRRIYEQSHGVLIDEEALQAAANLSARYISGRQLPDKAIDVLDTACARVAI
NLTTPPRAVSQLQTRLHQQALEIAQLERQGRIGLGDTQERLVTLREARETDAATLAQLEADWQHQKTLVQ
QIVALRTALLNDAPPEDFDAAAAAAELADNERALAELQQPSVLVSPHVDKTQIASVIAEWTGVPLNRISQ
GELDVVTRLPDYLGESIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMF
GGRHYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQA
FDKGELADGEGRLIDCRNVVFFLTSNLGFQTIVNFADRQSELLDALYPELAAFFKPALLARMEVIPYLPL
DHDTLVEIVQGKLSRLVTLLQQRFGAEVVIDDAVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQ
RLSAGQPVSRIHFRVEDGQFRSEVEG
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1447616-1450216 Dickeya dadantii Ech586 chromosome, complete genome
GTGATTCGAATCGAACTGCCGATCCTGGTTGAGCGACTCAACCCGCTGTGCCGCCACATGATGGAAGAAG
CGGCCGCGCTGTGTATTCAGCATCAGGGCGCGGAGATCCGCATTGAGCACCTGTTGCTGAAAATGCTGGA
AACACCGTTGTGCGACGTGCGCCAGATCCTCAAACGCGCTGGGGTAGAGGCCGACGAACTGGCGGCATTG
CTGCAACCCAATGCGGCGGATAAAGGCTTTGAGTCAGGCTACCCGTCGTTTTCACCGCTGCTGGTGGAGT
GGTTACAAGACAGCTGGTTGCTGGCTTCGGCTGAGCTTCAACACGCCCGCCTGCGCAGTGGCGTACTGCT
GCTGGTGCTGCTGATGACGCCGACGCGTTATCTGACGGCCGCGGTAACTCGCCAGCTGGCACAAATTAAC
CGTGAGCTGCTGCGCCAGCAGTTTGACGAGTGGGTGAAAGACTCGGCGGAAACCGAGGTGGTGACCGCCG
CAGGCGTCGCACCGGAGCAGGCTGCGACGGCGACCACCCAGCTCTCCCGTTACACCCAGAATGTCACCGA
GTCGGCCCGTCAGGGCAAGCTGGACCCGGTGTTGTGCCGCGATCACGAAATCGACCTGATGATCGATATC
CTCTCGCGCCGCCGTAAAAATAATCCGATTGTAGTCGGTGAGGCGGGGGTAGGGAAAAGCGCGCTGATTG
AAGGGCTGGCACTGCGTATCGTCGCCGGACTGGTGCCGGAACGGCTGCGGGATGTGGAATTGCTGACGCT
GGATCTGGGTGCCATGCAGGCCGGTGCGTCGGTGAAAGGCGAATTCGAGAAGCGCTTTAAAGGGGTGATG
CAGGAAGTCAAAGAGGCACCGAAGCCGATTGTGCTGTTCATTGACGAGGCGCACACACTGATTGGTGCGG
GTAATCAGGCCGGGGGGCTGGATGTATCCAACCTGCTGAAACCGGCGCTGGCTCGGGGGGAGTTGCGCAC
CATCGCGGCGACCACCTGGAGCGAGTACAAAAAATACGTGGAAAAAGACGCCGCGCTGTCGCGCCGTTTC
CAACTGGTGAAGGTGGGTGAGCCGAACGTCGAACAAGCCACGGTGATCCTGCGTGGGCTGCGCAGAATTT
ACGAACAGTCACACGGCGTGTTGATTGACGAGGAAGCGTTGCAGGCGGCGGCCAATTTGTCTGCGCGCTA
TATCTCCGGGCGTCAGTTGCCGGATAAAGCTATCGACGTGCTGGACACCGCCTGTGCGCGTGTCGCCATC
AATCTGACCACACCACCGCGCGCGGTCAGCCAGTTGCAGACCCGTCTGCACCAGCAGGCGCTGGAAATCG
CCCAGTTGGAACGGCAGGGCCGTATTGGGTTGGGTGATACGCAGGAGCGGCTGGTCACGCTGCGTGAGGC
TCGTGAAACCGATGCGGCGACACTGGCGCAACTGGAAGCCGACTGGCAACACCAAAAAACGCTGGTGCAG
CAGATTGTTGCCTTGCGTACCGCGCTGCTCAATGATGCGCCGCCGGAGGATTTTGATGCCGCCGCCGCGG
CGGCGGAGCTGGCCGATAACGAGCGGGCGCTGGCTGAACTACAACAGCCGTCAGTACTGGTGTCACCGCA
TGTGGATAAAACCCAGATTGCCTCGGTGATCGCCGAGTGGACCGGTGTGCCGCTAAACCGCATTTCCCAG
GGGGAACTGGATGTGGTCACCCGCCTGCCGGATTACCTTGGCGAGAGCATCAAAGGGCAGCAACTGGCTA
TCGCTCAGTTGCACAAACATCTGTTGACCGCCCGTGCCGACCTGCGCCGTCCCGGCCGACCGCTGGGGGC
CTTTTTGCTGGTGGGGCCGAGTGGGGTCGGTAAAACCGAAACCGTGGTGCAGATTGCCGATCTGATGTTT
GGCGGTCGTCATTACCTCACCACCATCAACATGTCCGAATACCAGGAGAAACACACGGTATCTCGCCTGA
TCGGCTCGCCGCCGGGGTATGTCGGCTTTGGCGAAGGCGGGGTGCTGACCGAAGCGATTCGCCAGAAACC
CTATTCGGTGGTGCTGCTGGATGAAGTGGAGAAAGCCCACCCGGATGTCCTCAACCTGTTCTATCAGGCG
TTTGATAAAGGCGAACTGGCCGATGGCGAAGGGCGACTGATCGACTGTCGCAACGTGGTGTTCTTCCTGA
CCTCCAACCTCGGGTTCCAGACGATTGTCAATTTTGCCGACCGGCAAAGCGAACTGCTGGATGCGCTCTA
CCCGGAACTGGCGGCGTTCTTCAAACCGGCGTTGCTGGCGCGTATGGAAGTGATCCCATACCTGCCGCTG
GACCACGACACGCTGGTTGAGATCGTACAGGGCAAGCTGTCCCGTCTGGTGACGTTGCTACAACAGCGCT
TTGGTGCCGAGGTAGTCATCGACGATGCCGTGCCGGAAGAAATTCTGCGTCTGGCCAACCGCAGCGAGAA
CGGGGCGCGCATGCTGGAGTCGGTGATCGACGGTGCGCTGCTGCCGCCGGTGTCGTTGCAGTTGCTGCAA
CGTCTGTCAGCCGGTCAGCCGGTCAGCCGTATTCATTTCCGGGTGGAAGACGGCCAGTTCCGGTCTGAGG
TGGAGGGCTGA