SecReT6
Protein ID: 271499864
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1302
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1452332..1453768 [+]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDD2BW14
KEGG IDddc:Dd586_1302
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-15, Aligned region: 49..109
ImpA-rel_N [PF06812], Evalue: 4.50E-15, Aligned region: 168..181
ImpA-rel_N [PF06812], Evalue: 4.50E-15, Aligned region: 400..411
Protein Sequence: 478 a.a.     [Download]
>gi|271499864|ref|YP_003332889.1| type VI secretion-associated protein, VC_A0119 family [Dickeya dadantii Ech586]
MHAHPWCKRLLTSLPDEALRAAVAADDPLWEQVETELVKLGSLAHSQVDLNAVAGQCLTLLESRTKDMRV
LVQLLRCLQHPAKATPFATAIMLLDSWLEAYWTVAFPASPAQKQKLMVQIIRRFEGVLPRMTEQASGAEL
GQLHQLAEQLASRWRGLASSNADLTDELVAALHRARQRHQAQEKANQAATAPTSGAQGATSAEGGTGNSG
HSSTASVAATVDINSSDDRSWKQTQLTVATLLIERQPEAPVGYRLRRNAIWAGITTPPMAARGNKTQLAP
VSPDRVDEYHSALGQADLALWNKIEQSLTLAPYWFDGHMLSATVATRLGHGAVASAIADELAAFLTRLPE
LRELSFSDGSPFLSAKCAQWLQSAQPGRGSGGIQRQDDLAAEAAACCAEQGLSAALSLLDERIRRLKEPR
ERFLAELVLADLLAEEGMKALAAQHYQHLWQESERLGLMQWEPGMVSRLERLSASRRK
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1452332-1453768 Dickeya dadantii Ech586 chromosome, complete genome
ATGCATGCACACCCCTGGTGTAAACGATTACTGACGTCATTGCCTGATGAGGCGCTACGTGCGGCGGTAG
CCGCGGATGACCCGTTGTGGGAGCAGGTGGAAACCGAGCTGGTCAAGTTGGGGTCGCTGGCGCACAGCCA
GGTGGATCTTAACGCGGTTGCCGGTCAATGCCTGACGTTGCTGGAGAGCCGAACCAAAGACATGCGGGTG
CTGGTGCAACTGCTGCGTTGCCTGCAACACCCGGCCAAGGCGACACCATTCGCCACCGCCATCATGTTGC
TCGATAGCTGGCTGGAGGCTTACTGGACGGTGGCGTTTCCGGCCAGTCCGGCACAAAAACAGAAGCTGAT
GGTGCAAATCATCCGCCGTTTTGAAGGCGTGCTGCCCCGTATGACGGAGCAGGCCTCGGGGGCGGAATTA
GGCCAGTTGCATCAGCTGGCGGAACAACTGGCCTCGCGCTGGCGTGGGCTGGCGTCCAGCAATGCGGACC
TCACCGATGAACTGGTGGCAGCGCTTCACCGTGCCCGGCAACGCCATCAGGCGCAGGAGAAAGCCAACCA
AGCGGCGACGGCACCGACGTCGGGCGCGCAAGGCGCAACCAGCGCGGAGGGGGGCACCGGGAACAGTGGT
CACAGCAGTACAGCCAGTGTGGCGGCGACGGTCGATATCAACAGTTCGGACGATCGTAGCTGGAAGCAGA
CGCAACTTACCGTAGCGACGTTGCTGATCGAGCGCCAGCCGGAAGCGCCGGTGGGATATCGCCTGCGCCG
TAATGCTATCTGGGCGGGGATTACCACCCCACCGATGGCGGCGAGAGGTAACAAAACCCAGTTAGCGCCG
GTATCGCCTGACCGGGTGGATGAATACCACAGCGCGCTTGGACAGGCAGATCTGGCGCTGTGGAACAAGA
TTGAACAGAGCCTGACGCTGGCACCGTACTGGTTTGACGGCCACATGCTGTCAGCGACGGTAGCGACCCG
GCTGGGGCATGGCGCTGTCGCCAGTGCCATCGCCGATGAACTGGCGGCGTTTCTCACCCGGCTGCCGGAA
TTACGCGAGCTGTCGTTTAGCGATGGGTCGCCGTTTCTGTCGGCCAAATGTGCCCAGTGGCTGCAATCCG
CCCAGCCAGGGCGTGGTAGCGGTGGCATTCAGCGACAGGACGACCTGGCGGCAGAGGCGGCGGCGTGCTG
CGCCGAGCAAGGGCTGAGCGCCGCGCTGTCGTTACTGGATGAACGCATTCGACGTTTGAAAGAACCGCGT
GAGCGTTTTTTGGCCGAGCTGGTATTGGCGGATTTACTGGCGGAAGAAGGCATGAAAGCACTGGCGGCAC
AGCATTATCAGCACCTGTGGCAGGAAAGCGAGCGATTGGGCCTGATGCAGTGGGAACCGGGAATGGTCAG
TCGACTGGAGCGGCTGAGCGCGTCCCGCAGGAAATAA