SecReT6
Protein ID: 271499866
SecReT6 ID373
T6SS typei1
Gene symbol-
Locus tagDd586_1304
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1457344..1458777 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDD2BW16
KEGG IDddc:Dd586_1304
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.60E-36, Aligned region: 324..472
ImpA-rel_N [PF06812], Evalue: 3.20E-19, Aligned region: 39..98
Protein Sequence: 477 a.a.     [Download]
>gi|271499866|ref|YP_003332891.1| ImpA domain-containing protein [Dickeya dadantii Ech586]
MQDAQQALKVGRDPRMLPEYEALRAEINKLSHASRPEVDWMRVHDMATAIFEKQGVDLQTAIYFTLARSR
LAGLNGFTEGCEFLANLIVTQWENFWPPVHQERARIEVLDWFIARISEVIRQYAISHEHKRLVYRCERAL
QLMSEKLHNSGLSRIPRVENLLHFIEGYTHLFDETEIVIVSDDQTLKKQQDMQIPPMVFFQSDMEPGGMA
SAAAAAQPALPSGSILVGREKGQMKPTVLKIEAHRKPKPGWFWFACGVLSCALPVAAITGWQYWQNQKAE
ALALLQQPAYTLPAAPDHNDIRRVRIVLGEQKLQSMEGELINRYQAQLEQVKNASSFYLYQYGEGLKGVM
QQLYPDSLAVKEMDRQWQIALDRQQGDKPPRVSGYELARAEVGDTLQQLLDLEKQRRTVTISYLKSQLYD
IQKDLSSDVPFGIRLRTLEARKAASQSLTPAELRGMEDELRAFTIRLYRLQQGESGR
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1457344-1458777 Dickeya dadantii Ech586 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTGGGCCGTGATCCACGGATGCTGCCTGAGTACGAGGCGTTAC
GCGCGGAAATCAACAAGCTAAGCCATGCATCCCGCCCGGAAGTGGACTGGATGCGGGTGCACGATATGGC
GACCGCGATTTTTGAAAAGCAGGGCGTCGACCTGCAAACCGCTATCTATTTCACCCTGGCGCGCTCGCGT
CTGGCCGGGTTGAACGGTTTTACCGAAGGGTGCGAGTTTCTCGCCAACCTGATCGTGACCCAGTGGGAGA
ATTTCTGGCCGCCGGTGCATCAGGAACGGGCGCGTATCGAAGTGTTGGACTGGTTTATCGCCCGCATCAG
CGAGGTGATCCGCCAATACGCTATCAGCCACGAACATAAGCGGCTGGTGTATCGCTGCGAGCGCGCGCTG
CAATTAATGAGCGAAAAGCTGCATAACTCGGGCCTGAGCCGTATTCCGCGGGTGGAAAACCTGCTGCACT
TTATCGAAGGCTATACCCATCTGTTCGATGAAACCGAGATTGTGATTGTGTCTGACGATCAGACACTGAA
GAAACAGCAGGACATGCAGATCCCGCCGATGGTGTTCTTCCAGTCTGATATGGAGCCGGGCGGCATGGCG
TCTGCGGCCGCCGCCGCCCAGCCAGCGCTGCCGTCGGGCAGTATTTTGGTCGGGCGGGAGAAAGGGCAGA
TGAAACCTACCGTATTGAAAATTGAAGCGCACCGTAAGCCGAAACCGGGCTGGTTCTGGTTTGCTTGCGG
TGTGCTGAGCTGTGCGCTGCCGGTAGCGGCCATCACCGGCTGGCAGTACTGGCAGAATCAGAAAGCCGAG
GCGCTGGCGCTGTTACAGCAACCAGCGTACACGCTGCCTGCTGCACCGGATCATAACGACATTCGCCGGG
TACGCATCGTGCTGGGTGAGCAGAAGCTGCAAAGCATGGAAGGCGAACTGATCAACCGCTATCAGGCGCA
ACTGGAGCAGGTGAAAAACGCCTCGTCGTTCTACCTCTACCAGTATGGCGAGGGGCTTAAAGGCGTGATG
CAACAACTGTATCCCGATTCGCTGGCGGTGAAAGAGATGGACCGACAGTGGCAGATAGCCCTCGACCGTC
AGCAAGGTGACAAGCCGCCGCGTGTCAGCGGTTACGAGCTGGCGCGCGCCGAAGTGGGCGATACCCTGCA
ACAGTTGCTGGATTTGGAAAAACAGCGCCGGACGGTAACCATTTCGTACCTGAAATCTCAACTTTATGAT
ATCCAAAAAGATTTGTCCTCCGACGTGCCTTTTGGCATTCGCCTGCGGACGCTGGAGGCGCGCAAAGCCG
CCAGTCAGTCGCTGACCCCGGCGGAATTACGCGGTATGGAAGACGAACTGCGTGCTTTCACCATCCGGCT
GTACCGCTTGCAACAAGGCGAGAGCGGCAGGTAA