SecReT6
Protein ID: 27378698
SecReT6 ID39
T6SS typei3
Gene symbolclpB
Locus tagbll3587
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3962178..3964817 [-]
ProductATP-dependent Clp protease ATP-binding subunit
NoteTssH
UniProt IDQ89P96
KEGG IDbja:bll3587
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.30E-42, Aligned region: 231..249
AAA_2 [PF07724], Evalue: 4.30E-42, Aligned region: 611..777
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 231..331
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 617..735
ClpB_D2-small [PF10431], Evalue: 9.90E-17, Aligned region: 784..860
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 616..734
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 276..309
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 608..661
AAA_16 [PF13191], Evalue: 1.70E-12, Aligned region: 781..849
Sigma54_activat [PF00158], Evalue: 4.30E-08, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 4.30E-08, Aligned region: 615..734
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 230..312
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 614..645
AAA_19 [PF13245], Evalue: 5.40E-06, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 5.40E-06, Aligned region: 614..638
Zeta_toxin [PF06414], Evalue: 1.50E-05, Aligned region: 230..254
Zeta_toxin [PF06414], Evalue: 1.50E-05, Aligned region: 609..656
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 231..311
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 615..697
IstB_IS21 [PF01695], Evalue: 6.40E-05, Aligned region: 213..250
IstB_IS21 [PF01695], Evalue: 6.40E-05, Aligned region: 616..635
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 231..257
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 286..327
NACHT [PF05729], Evalue: 7.70E-05, Aligned region: 617..644
Arch_ATPase [PF01637], Evalue: 8.80E-05, Aligned region: 210..251
Arch_ATPase [PF01637], Evalue: 8.80E-05, Aligned region: 282..315
Arch_ATPase [PF01637], Evalue: 8.80E-05, Aligned region: 616..637
AAA_17 [PF13207], Evalue: 0.00022, Aligned region: 231..251
AAA_17 [PF13207], Evalue: 0.00022, Aligned region: 616..652
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 215..255
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 284..315
AAA_25 [PF13481], Evalue: 0.00035, Aligned region: 614..638
AAA_18 [PF13238], Evalue: 0.0008, Aligned region: 231..251
AAA_18 [PF13238], Evalue: 0.0008, Aligned region: 618..641
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 223..246
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 614..641
NTPase_1 [PF03266], Evalue: 0.005, Aligned region: 231..253
NTPase_1 [PF03266], Evalue: 0.005, Aligned region: 283..307
NTPase_1 [PF03266], Evalue: 0.005, Aligned region: 616..637
RNA_helicase [PF00910], Evalue: 0.0056, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0056, Aligned region: 534..551
RNA_helicase [PF00910], Evalue: 0.0056, Aligned region: 617..638
RNA_helicase [PF00910], Evalue: 0.0056, Aligned region: 714..735
Protein Sequence: 879 a.a.     [Download]
>gi|27378698|ref|NP_770227.1| clpB gene product [Bradyrhizobium japonicum USDA 110]
MTDISIEAVTGKLNRAGYDAFLQALRHAKSAGNRNVELAHWLFHILQQERNDLSLSVDHYKLDRARLLSD
LAGVINGFRKNETDMPGVANSVIDLLDRGWHYATLFFGETQIRTGHLLVAGLKSNDIRRTLNNLSQEFSK
VNVDALAAERRAVWAGSDEETMRPMDGSGLVGAVTEGAAQAGPKGTTPLDRFSQDLTAKAKSGEMDPILG
RDEEIRQLIDVLMRRRQNNPILTGEAGVGKTAVVEGFAQRIAAGDVPPPLRGVRLCALDIGLMQAGASMK
GEFEQRLRSVIDEVQSSPTPIILFIDEAHTLIGAGGAAGTGDAANLLKPPLARGTLRTIAATTWAEYRQY
IEKDPALTRRFQPIQIDEPDVETCCIMLRGLLGPMEKHHGVRISDAAIVAAVNLSHRYIPSRQLPDKAVS
LLDTASARVAISQSATPALIEDARVAIAAREAERSALVSDSDLGIEDDERIVAIDNDVAALKDKLTNLEA
DWAAEQELVKDIRGIREILSEPMEGDDPAARRAELRGKFDTLESINPEKRMVYAYVDQQSVASVVSDWTG
IPVGRMMRDEIETVLKLPEILNRRVVGQSHGLTMIAKRIETSRAKLDNPSKPIGVFMLAGPSGVGKTETA
LALAETLYGGEQNMITINMSEFQEAHTVSTLKGAPPGYVGYGEGGRLTEAVRRKPYSVILLDEVEKAHPD
VHEIFFQVFDKGTMEDGNGRRIDFKNTLIILTTNVGTDLIMGLSRDPKYRSEPEELAKMLRPELLKVFPA
ALLGRIVSIPYFPLSDEMLAGIARLQLDRIGRRLRDNHNAAFSYDDAVVEHIVSRCNDPDSGGRMIDNII
TNTLLPELSREFLSKSLAKEEVKQARVSIENDKFAYSWN
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3964817-3962178 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGACCGACATCAGCATTGAAGCTGTAACGGGCAAGCTGAACCGGGCCGGCTATGATGCCTTCTTACAGG
CCCTGCGCCACGCAAAGAGCGCCGGCAATCGCAACGTCGAGCTTGCGCACTGGCTGTTTCATATCCTGCA
GCAGGAACGCAACGATCTCAGCCTCTCGGTCGATCATTACAAGCTCGACCGCGCACGCTTGTTGTCGGAC
CTTGCCGGCGTGATCAATGGCTTTCGTAAGAACGAAACCGACATGCCGGGCGTCGCCAATTCGGTCATCG
ATCTGCTCGATCGGGGCTGGCATTATGCCACGCTCTTCTTTGGCGAGACCCAGATCCGCACCGGTCATCT
GCTTGTGGCAGGCCTGAAATCGAACGATATTCGTCGCACGCTGAACAACCTCTCGCAGGAATTTTCCAAG
GTCAACGTCGACGCACTGGCCGCGGAGCGTCGCGCCGTCTGGGCCGGCTCCGACGAGGAGACCATGCGAC
CGATGGACGGTTCGGGCCTGGTCGGCGCCGTCACGGAAGGCGCGGCCCAAGCGGGTCCAAAGGGGACGAC
GCCGCTCGACCGGTTCTCCCAGGATCTCACCGCCAAGGCCAAATCGGGCGAGATGGATCCGATCCTTGGT
CGGGACGAAGAAATCCGCCAACTGATCGACGTGTTGATGCGTCGGCGGCAGAACAATCCAATCCTCACCG
GCGAGGCTGGCGTCGGCAAGACCGCAGTTGTCGAGGGCTTCGCCCAGCGTATCGCCGCCGGCGACGTGCC
GCCACCGCTCCGCGGTGTAAGGCTTTGTGCGCTCGACATCGGCCTGATGCAGGCCGGTGCCTCCATGAAG
GGCGAGTTTGAGCAGCGCTTGCGGTCGGTGATCGACGAGGTCCAGAGCTCACCCACCCCCATCATCCTGT
TCATCGATGAAGCCCACACACTGATCGGCGCCGGCGGCGCGGCCGGCACCGGTGATGCAGCCAATCTCCT
GAAACCTCCCCTTGCGCGTGGCACGCTGCGCACGATCGCCGCCACCACGTGGGCAGAATATCGCCAGTAT
ATCGAGAAAGATCCCGCGCTCACACGACGCTTCCAGCCGATCCAGATCGATGAACCCGATGTGGAAACCT
GCTGCATCATGCTGCGCGGACTCCTCGGTCCGATGGAAAAGCACCACGGCGTTCGCATCTCGGATGCCGC
GATCGTCGCAGCGGTCAACCTGTCCCACCGCTACATTCCTTCACGGCAGTTACCCGACAAGGCGGTCAGC
CTGCTTGATACCGCCTCGGCGCGCGTGGCGATCAGCCAGAGCGCGACTCCGGCCCTGATCGAGGATGCAC
GCGTTGCGATTGCCGCCCGTGAAGCTGAGCGATCAGCACTCGTCAGCGACAGCGATCTTGGGATTGAGGA
CGACGAGCGCATCGTAGCGATCGACAACGACGTCGCAGCATTGAAGGACAAGCTGACGAACCTCGAAGCC
GATTGGGCCGCAGAGCAGGAGCTCGTCAAGGACATCCGGGGCATTCGGGAGATCCTGTCCGAACCCATGG
AAGGCGACGATCCGGCTGCCAGGCGCGCGGAGCTGCGCGGCAAGTTCGACACGCTTGAGAGCATCAATCC
GGAAAAGCGGATGGTCTATGCCTATGTGGACCAGCAGTCGGTGGCGTCCGTTGTCTCTGACTGGACTGGC
ATCCCGGTCGGCCGGATGATGCGCGACGAGATCGAAACCGTGCTGAAACTACCGGAGATCCTCAACCGCC
GCGTCGTCGGCCAGTCTCATGGGCTGACGATGATCGCCAAGCGAATCGAGACCAGCCGCGCCAAACTGGA
CAACCCGTCGAAGCCGATCGGCGTGTTCATGCTGGCTGGTCCATCCGGCGTGGGCAAGACCGAAACCGCC
CTGGCGCTTGCCGAGACCCTCTACGGCGGCGAGCAGAACATGATCACGATCAACATGTCGGAGTTCCAGG
AAGCGCACACCGTCTCGACCTTGAAGGGAGCGCCTCCCGGCTATGTCGGCTATGGAGAAGGTGGACGCCT
CACCGAGGCTGTCCGGCGCAAGCCCTATAGCGTCATCCTGCTCGACGAGGTCGAGAAAGCTCATCCCGAC
GTCCATGAGATCTTCTTCCAGGTGTTCGACAAGGGAACCATGGAGGACGGCAACGGGCGGCGGATCGACT
TCAAGAACACGTTGATCATCCTGACCACCAACGTCGGCACCGATCTGATCATGGGCCTCTCGCGAGATCC
AAAGTATCGCAGCGAACCGGAAGAGCTCGCCAAGATGCTGAGGCCGGAATTGCTGAAGGTGTTTCCGGCA
GCGCTGCTCGGACGCATCGTCTCGATACCGTACTTCCCGCTATCCGACGAAATGCTCGCCGGGATCGCTC
GGTTGCAGCTCGACCGGATCGGACGACGCCTCCGTGACAACCATAACGCGGCATTCAGCTACGATGACGC
GGTCGTGGAGCACATTGTGTCACGTTGCAACGACCCGGACTCTGGCGGGCGAATGATTGACAACATCATC
ACCAACACCCTGCTCCCGGAGCTGTCACGCGAATTCCTCAGCAAGTCGCTTGCCAAGGAAGAAGTCAAGC
AAGCGCGGGTCTCGATCGAGAACGACAAGTTCGCATATTCGTGGAATTGA