SecReT6
Protein ID: 27378699
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3588
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3964915..3965979 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ89P95
KEGG IDbja:bll3588
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-99, Aligned region: 20..320
Protein Sequence: 354 a.a.     [Download]
>gi|27378699|ref|NP_770228.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MATAHGHAETAMTLIDQMKAEPWRFDFFHTLRQFERANPDRPRIGDSAARRDEYIDLGQVPYLEFPASNL
AAVDDQGARLRILVKFLGLLGPQGALPLATTDESLSWWLMRDDAFPRFLDLLNGRFLQLFFRAWADARPI
AQHDRPADDRFIAYVGSFAGLGSDVFADRDAVPDMAKLSFAGLVAPRAKCASRLTRFLQGLFDVKVEIDE
FVGTWLSFDPSHCSRLGGTHARLGQDALLGSRVFSVEDKIRVRVFVRTFAQYEQFLPTETPNLSAPLADA
VFFYIGDELEWEVELAIPAGEVVPVRLGQSGRLGWTTWVSPNWASTEEYRRDARFQLGERLRARRSATAN
AAAI
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3965979-3964915 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGGCCACCGCGCATGGGCACGCGGAGACCGCTATGACGCTGATCGACCAGATGAAGGCCGAGCCCTGGC
GCTTCGATTTCTTCCATACGTTACGCCAGTTCGAGCGCGCCAACCCGGATCGACCGCGGATCGGCGACAG
TGCCGCGCGTCGCGACGAATATATCGACCTCGGCCAGGTGCCTTATCTGGAGTTCCCCGCCTCGAACCTC
GCGGCGGTGGACGACCAGGGTGCCCGGCTGAGGATACTCGTCAAATTTCTCGGCCTCCTGGGCCCGCAGG
GCGCCCTGCCCCTTGCCACCACCGATGAAAGCCTCAGCTGGTGGCTGATGCGGGATGACGCCTTCCCCCG
CTTTCTCGACCTCCTCAACGGACGCTTCCTGCAACTCTTCTTTCGTGCCTGGGCCGACGCGCGCCCGATC
GCGCAGCATGACCGCCCGGCGGACGATCGCTTCATTGCCTATGTCGGCTCCTTCGCCGGCTTGGGCTCCG
ATGTTTTCGCCGATCGCGATGCGGTTCCGGACATGGCGAAGCTCAGCTTCGCTGGACTGGTCGCGCCCAG
GGCGAAGTGTGCATCACGATTGACGCGGTTCCTGCAAGGACTGTTCGACGTCAAAGTCGAGATCGACGAA
TTCGTCGGCACCTGGCTCTCATTCGACCCAAGTCACTGCAGCCGGCTCGGCGGAACGCATGCGAGGCTCG
GCCAGGACGCCCTTCTCGGCTCGCGTGTGTTCAGCGTCGAGGACAAGATCAGAGTTCGGGTCTTTGTCAG
AACTTTTGCTCAGTACGAACAATTCCTGCCGACCGAAACACCCAACCTGTCGGCGCCGCTGGCCGACGCC
GTTTTCTTCTATATCGGCGACGAATTGGAATGGGAGGTCGAGCTCGCCATTCCGGCGGGAGAGGTCGTCC
CGGTCAGGCTTGGACAGAGTGGGCGACTTGGATGGACCACCTGGGTCTCGCCGAACTGGGCCTCCACGGA
AGAATATCGCCGCGATGCCCGCTTTCAGCTCGGCGAACGATTGAGAGCCCGCCGGAGTGCCACAGCGAAT
GCCGCGGCGATTTGA