SecReT6
Protein ID: 27378700
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3589
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3965943..3966599 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ89P94
KEGG IDbja:bll3589
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.60E-54, Aligned region: 2..217
Protein Sequence: 218 a.a.     [Download]
>gi|27378700|ref|NP_770229.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MFLSLLEPGELSGGGSVAELSVRALCSNRHLTEHLPVGQGGADFRLLDDTSLDLMCVAGPTPPREPVVAQ
LRSRSEIANSGIVSWRLINMLSLNYLGLVERGGGKNAGALREMLALFADQFDDATERKIRGVRSIESRPV
VRRVRERTGSGAARGLEITVTLDEKAFEGSGVFLLGAILERFFADYSGFNTFTQTVISTPERGEIMRWPP
RMGTRRPL
 
Nucleotide Sequence: 657 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3966599-3965943 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGTTCCTGTCGCTGCTTGAGCCCGGCGAATTGAGTGGCGGAGGCTCCGTCGCCGAACTGAGCGTCCGGG
CTCTGTGCTCCAATCGCCATCTCACCGAGCACTTGCCGGTCGGCCAGGGCGGCGCCGACTTTCGGCTGCT
GGACGATACCTCCCTTGATCTGATGTGTGTCGCTGGTCCCACGCCACCGCGTGAGCCGGTGGTTGCCCAA
CTGCGCAGCCGCAGCGAAATCGCCAACAGTGGGATTGTCAGCTGGCGGCTGATCAACATGCTCAGCCTCA
ACTATCTTGGCCTCGTCGAACGCGGTGGCGGCAAGAACGCCGGAGCGCTGCGCGAGATGCTGGCCTTGTT
CGCCGATCAGTTCGACGACGCCACGGAGCGCAAGATCCGCGGCGTGCGCAGCATAGAAAGCCGACCTGTC
GTGCGGCGCGTGCGCGAGCGCACGGGTAGCGGCGCAGCACGGGGCCTGGAGATTACCGTTACGCTCGACG
AGAAGGCATTTGAGGGCAGCGGCGTGTTTTTGCTCGGAGCAATACTGGAGCGCTTCTTCGCCGACTATTC
GGGCTTCAACACCTTCACTCAGACGGTCATCTCGACGCCGGAGCGCGGCGAGATCATGCGGTGGCCACCG
CGCATGGGCACGCGGAGACCGCTATGA