SecReT6
Protein ID: 27378701
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3590
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3966580..3967911 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ89P93
KEGG IDbja:bll3590
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-106, Aligned region: 5..412
Protein Sequence: 443 a.a.     [Download]
>gi|27378701|ref|NP_770230.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MNREFLDFYNRELSLLYEQAGDFAEEYPGIAERLGGLIRDRSDPMITGLLEGAAFLAARVQLKLKHEFPE
FTANLLEQLVPNYLAPTPSAMLVAARPPYADPALRDGKKIVRGAYFDATYRERERSLSCRFRLCRDIVLW
PFDVTSAEYFSTAGTLQALGIPVGGDVIAGLKLSLTHRTAARLDEELPDAEARAKPETWFAGCRVSELPI
YLSGAESDAIALYEQLISNCKGVYFRHLDDFGDPVVTRAPHDCVQQIGFDENESLFPNDNRIFRGSELLR
EYFMFPRKFLGINLTGLRSVMSRLRSKSIDIVFAFDEHNSRLAASVRPETFRLYTAPAINLFEKTSDRIP
VKSNTYEYHVVPDRSRYLEYEPHQVLEVYAHLPAEKDKRPVRPLYSAAVDRTSGSVDGALFHRPPLTPAP
HSRGEDIRYFLRLHRDGHVPVAA
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3967911-3966580 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGAATCGCGAATTCCTCGATTTCTACAATCGTGAACTGTCATTGCTGTACGAGCAGGCAGGAGATTTCG
CCGAAGAATATCCTGGCATCGCAGAGCGCCTCGGCGGCCTCATCCGGGACCGCTCGGACCCGATGATCAC
GGGACTATTGGAAGGCGCCGCGTTTCTTGCCGCCCGCGTTCAGCTCAAGCTCAAGCACGAATTCCCGGAA
TTCACTGCAAACCTGCTTGAGCAGCTGGTACCGAACTATCTTGCGCCCACACCGTCGGCGATGCTCGTCG
CGGCACGGCCACCCTACGCCGACCCAGCGCTGCGCGACGGCAAGAAGATTGTACGCGGCGCCTATTTCGA
CGCGACCTACCGCGAGAGAGAACGAAGTCTTTCCTGCCGGTTTCGACTTTGCCGCGACATCGTGCTCTGG
CCGTTCGACGTCACCAGCGCAGAGTATTTCTCCACAGCGGGCACTCTGCAGGCGCTCGGGATCCCGGTCG
GAGGCGACGTCATCGCGGGGCTGAAGCTGTCGCTGACCCATCGTACCGCAGCCCGGCTCGACGAGGAACT
ACCGGACGCAGAGGCCCGAGCCAAGCCGGAAACCTGGTTCGCAGGCTGCCGCGTGAGCGAACTTCCGATC
TACCTCTCAGGCGCGGAATCCGACGCCATCGCGCTCTACGAGCAATTGATCTCGAATTGCAAAGGAGTCT
ACTTCCGGCATCTCGACGACTTCGGCGATCCGGTGGTGACTCGTGCGCCCCATGATTGCGTGCAGCAAAT
TGGCTTCGACGAAAACGAGTCGCTGTTCCCTAACGACAATCGGATCTTTCGCGGTTCGGAGCTGCTGCGA
GAATATTTCATGTTTCCACGCAAGTTCCTCGGCATAAACCTGACGGGACTACGCAGCGTGATGTCGCGAC
TGCGCAGCAAATCGATCGATATTGTCTTCGCTTTCGATGAACACAATTCGCGGCTGGCTGCCTCGGTGCG
CCCCGAGACCTTCAGGCTCTATACTGCACCGGCGATCAATCTGTTCGAGAAAACGAGCGATCGCATTCCT
GTCAAGTCGAATACTTACGAGTACCATGTGGTGCCAGATCGCAGCCGCTATCTGGAATACGAACCGCACC
AGGTGCTCGAGGTCTACGCGCACCTGCCGGCAGAGAAGGATAAACGGCCCGTGCGCCCGCTCTATTCGGC
CGCCGTCGACCGGACCAGCGGATCGGTCGACGGGGCTCTATTTCACCGTCCGCCGCTTACCCCGGCGCCG
CACAGTAGAGGAGAAGACATACGGTACTTCCTCAGACTACACCGGGACGGACATGTTCCTGTCGCTGCTT
GA