SecReT6
Protein ID: 27378702
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3591
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3967913..3968461 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ89P92
KEGG IDbja:bll3591
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.60E-19, Aligned region: 55..161
Protein Sequence: 182 a.a.     [Download]
>gi|27378702|ref|NP_770231.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MTIAPKRDRLSPPLMLAFRSAHEARDARKKLNLRDEFGERIIAGRRSAGRFPISETLLRREVSHDLETLL
NTIALESTLDLSGRDSVRTSILNYGFPDIAHRSIDEVTDDELTGALRETLTTYEPRLDRKTIRVRRDGSV
GPEQLKLRFIVHADLKAEPLNVPVEFVADVDLDSGDIQINRL
 
Nucleotide Sequence: 549 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3968461-3967913 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGACCATTGCTCCAAAGAGGGATCGGCTCTCTCCCCCATTAATGCTGGCCTTTCGCTCCGCTCATGAAG
CACGCGATGCGCGCAAGAAGCTCAATCTGCGCGATGAGTTCGGTGAGCGGATCATTGCCGGGCGGCGCAG
CGCAGGCCGCTTTCCGATCTCGGAAACGTTGTTGCGGCGGGAGGTCTCCCATGACCTTGAAACGCTCCTC
AATACCATTGCTCTGGAATCGACCTTGGATCTGAGCGGGCGGGATAGCGTTCGAACCTCGATCCTGAACT
ACGGCTTCCCCGATATCGCCCACCGTTCGATCGACGAGGTCACGGACGACGAACTCACCGGCGCCCTGCG
CGAGACTCTGACGACGTACGAGCCAAGACTCGATCGCAAGACGATCCGGGTCCGTCGCGACGGCTCGGTC
GGTCCCGAGCAGCTGAAGCTGCGCTTCATCGTTCACGCCGACCTCAAGGCTGAGCCGCTCAACGTCCCCG
TGGAATTTGTCGCCGACGTCGACCTCGACAGCGGCGACATCCAAATCAATCGACTTTAG