SecReT6
Protein ID: 27378703
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3592
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3968644..3969129 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ89P91
KEGG IDbja:bll3592
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.90E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|27378703|ref|NP_770232.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MAVDIFLKLDPIKGESLDDKHKDEIDILSWSFGESQSGTFHSGSGGGAGKVSVQDLHFTHFVDKATPELF
KVCANGKHIDTAILTVRKAGENPLEYLKIEMKHILVTSVSTGGSHGEDRLTENVSLNFAKVKMTYKTQTE
KGGAGAAPVFGWDVPANKEWA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3969129-3968644 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGGCTGTCGACATCTTCTTGAAACTCGATCCGATCAAGGGCGAGTCGCTGGACGACAAGCACAAGGACG
AAATCGATATTTTGAGCTGGTCTTTCGGCGAAAGCCAGTCAGGCACTTTCCACAGCGGTTCGGGCGGCGG
CGCCGGCAAGGTCAGCGTCCAGGATCTCCACTTTACGCACTTCGTCGACAAGGCCACGCCGGAGCTTTTC
AAGGTCTGCGCGAACGGCAAGCACATTGACACGGCGATCCTCACGGTCCGCAAGGCGGGCGAAAATCCGC
TGGAGTATCTCAAGATCGAGATGAAGCACATTCTAGTCACCAGCGTATCGACGGGCGGATCGCACGGTGA
AGATCGCCTCACCGAAAACGTGAGTCTGAACTTCGCGAAGGTCAAGATGACCTACAAGACCCAGACAGAA
AAAGGCGGCGCTGGAGCTGCGCCGGTGTTTGGCTGGGACGTTCCCGCCAACAAGGAATGGGCCTGA