SecReT6
Protein ID: 27378704
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3593
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3969180..3970691 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ89P90
KEGG IDbja:bll3593
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-183, Aligned region: 70..499
Protein Sequence: 503 a.a.     [Download]
>gi|27378704|ref|NP_770233.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MGTMAKEAVHKESTTQVKTVEADEFATLLKQSFKPRTERAATEVENAVSTLVQEALKDTSVIKSDVLDTI
EEMIARIDQKLTAQMNEILHTPEFQSIESAWRGLHYLVFNSETDANLKIRVMNVSKNELYRNLRLYPDAR
WDQSPLFKQIYEYEFGQLGGEPFGCLIGDYYFSHLPTDVQLLRDLSKIAGAAHAPFFSGAEPTLMGMDSW
TELSNPRDIGKVFDTPEYAAWKGLRDQDDSRYLGLCMPRALGRLPYGAKSEPVEEFAFEEETDGHTGDKY
GWINAAYAMAVNINRAFKEFGWCTRIRGVQSGGEVINLPTHTFPTDDGGVDLKCPTEIAISDRREHELAK
AGLIPLIHRKNTDKAAFIGAQSLYKPKKYFGEKGVDATASDNLSSRLPYMFAVSRFAHYLKCMVRDKIGS
MKEKDELTIWLQTWINEYVDANPALSSEAQKARKPLAAAKVEVIANEENPGYYNARFFLRPHFQLEAMDV
GLSLVSRLPGPAS
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3970691-3969180 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGGGGACCATGGCAAAAGAAGCTGTTCACAAAGAGAGCACCACCCAGGTCAAGACCGTCGAAGCTGACG
AGTTTGCCACTCTGTTGAAGCAAAGCTTCAAACCCCGCACAGAACGCGCAGCGACCGAAGTCGAAAACGC
GGTATCCACGCTCGTTCAAGAGGCGTTGAAGGACACGAGCGTCATCAAGTCGGACGTCCTCGACACCATC
GAGGAGATGATCGCGCGGATCGACCAGAAGCTGACCGCGCAAATGAACGAAATTCTTCACACACCTGAGT
TCCAGTCAATCGAAAGTGCTTGGCGCGGCCTCCACTACCTCGTCTTCAATTCCGAGACCGACGCCAACCT
CAAGATCCGGGTGATGAACGTCTCCAAGAACGAGTTGTATCGGAATCTGCGGCTTTACCCCGATGCGCGC
TGGGACCAGAGTCCCCTGTTCAAGCAGATCTACGAGTATGAATTCGGCCAGCTGGGCGGCGAACCGTTTG
GCTGCCTGATCGGCGACTACTATTTCAGCCACCTCCCAACCGACGTACAGTTGCTCCGCGATCTCAGCAA
GATCGCCGGCGCCGCGCACGCTCCCTTCTTCAGCGGCGCCGAGCCGACGCTGATGGGAATGGACTCTTGG
ACCGAGCTGTCCAACCCTCGCGACATCGGTAAGGTGTTCGACACGCCGGAGTATGCCGCATGGAAGGGGC
TGCGCGATCAGGACGACTCGCGCTATCTCGGCCTGTGCATGCCCCGCGCGCTCGGCCGCCTCCCCTACGG
CGCGAAATCGGAGCCCGTGGAAGAGTTCGCCTTCGAAGAGGAGACGGACGGACACACCGGCGATAAATAC
GGCTGGATCAACGCCGCCTACGCAATGGCGGTCAACATCAACCGCGCCTTCAAGGAATTTGGCTGGTGCA
CGCGGATCCGCGGCGTGCAGTCCGGTGGCGAAGTCATCAACCTGCCGACGCACACATTCCCGACCGATGA
CGGCGGCGTCGACCTGAAATGCCCGACCGAGATCGCCATCAGTGATCGCCGCGAGCACGAACTTGCAAAG
GCGGGCCTCATCCCGCTGATCCATCGCAAGAACACCGACAAGGCCGCCTTCATCGGCGCCCAGTCACTCT
ACAAGCCGAAGAAGTACTTCGGCGAAAAGGGCGTGGATGCCACCGCGTCCGACAACTTGTCGTCACGACT
ACCTTACATGTTCGCAGTGTCCCGCTTTGCCCACTATCTGAAGTGCATGGTTCGCGACAAGATCGGATCC
ATGAAGGAGAAGGATGAGCTGACGATCTGGCTGCAAACCTGGATCAACGAATACGTTGATGCCAACCCAG
CCCTCTCGTCAGAAGCTCAGAAAGCGCGCAAGCCACTGGCCGCTGCGAAGGTTGAAGTCATCGCAAACGA
GGAGAATCCGGGATATTACAACGCGCGCTTCTTTCTTCGTCCACACTTTCAGTTGGAGGCGATGGACGTC
GGCCTCAGCCTGGTTTCACGCCTACCCGGCCCCGCTTCCTGA