SecReT6
Protein ID: 27378705
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3594
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3970699..3971250 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ89P89
KEGG IDbja:bll3594
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-53, Aligned region: 18..173
Protein Sequence: 183 a.a.     [Download]
>gi|27378705|ref|NP_770234.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MRFRSEGTMATDSGQKFIRRNRAPRVHITYEDPYDAERLIELPFVMGVLSDLSGNNPGVEKTKVEERKFL
EFDMDNFDNRMAAIQPGVTARVANRLSDGSDEKISVNLRFNKMADFTPVAVARQVPAAAKLLEAREQLAN
LLRYMDGKVAAEDQLKKLLADPQLMAALRERATSQSTEPGTES
 
Nucleotide Sequence: 552 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3971250-3970699 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGCGATTTCGTAGTGAGGGAACCATGGCTACAGACAGCGGTCAAAAATTCATTCGGCGAAACCGCGCAC
CACGCGTGCACATCACATACGAAGATCCTTACGACGCCGAGCGGCTGATCGAACTGCCGTTCGTCATGGG
CGTCCTCTCCGACCTCTCCGGCAATAACCCTGGCGTCGAGAAGACGAAGGTCGAGGAGCGCAAGTTCCTC
GAGTTCGACATGGACAATTTCGACAACCGCATGGCGGCAATCCAGCCCGGCGTGACGGCGCGTGTCGCCA
ATCGCCTCAGCGATGGATCCGACGAAAAGATCTCGGTCAACCTGCGCTTCAACAAGATGGCAGACTTCAC
GCCGGTGGCCGTCGCCCGCCAGGTGCCGGCTGCTGCCAAGCTGCTCGAGGCGCGCGAACAACTCGCCAAC
CTGCTGCGCTACATGGATGGCAAGGTGGCCGCCGAGGACCAGCTCAAAAAACTTCTCGCCGATCCTCAAC
TGATGGCGGCGCTTCGGGAACGCGCGACAAGCCAGTCGACCGAACCTGGCACCGAGAGCTAA