SecReT6
Protein ID: 27378706
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagbll3595
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3971366..3972706 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ89P88
KEGG IDbja:bll3595
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.90E-05, Aligned region: 80..130
ImpA-rel_N [PF06812], Evalue: 9.90E-05, Aligned region: 243..254
Protein Sequence: 446 a.a.     [Download]
>gi|27378706|ref|NP_770235.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MTEQMDDRCMLDVASLTHPVAADDPCGPDLDAIGDIQYLNFFAGAESLLPMSFFEVVNANGERGRFDPKA
VDFAGQFAAAQPLLERTRDLRLNLLLAKFSILNRDLDGFLCCLKATNFLLREQWEAVHPKGEDGDYALRA
VTVEAIDVFPTVINPLQFLPLIENRRHGNLNYRAYQVAMGEIPAGDADADGPDLAAIERIVSETDLDTLK
ATSARCSAVAAEIAGIKQTWHEKLNAGQPISLDRLSGLVNGMAAWLAGLVALRDPAAIAATAEDVGPVDT
QAPSDTSGVVTSSAQASAALAAAADYFARMEPSNPALLLVRQAQEMVGKSFIEVMRMLVPAHVESAAINI
GRDKVFDLPIERMAELATSLSSTAESSAQDIVFSIENRAQALGLLTKVASFFRTAEPSSPIPFLVDRARD
LAQRDFLSLLNDVLPEGALKTIDRSH
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c3972706-3971366 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGACCGAGCAGATGGACGATCGTTGTATGCTTGATGTCGCCTCCCTGACGCACCCCGTTGCCGCTGACG
ATCCCTGCGGGCCGGATCTCGACGCCATCGGAGACATCCAGTATCTGAACTTCTTCGCAGGTGCGGAATC
GCTGCTGCCGATGTCGTTCTTCGAGGTCGTCAATGCCAACGGAGAGCGTGGACGCTTCGATCCAAAGGCA
GTCGATTTTGCCGGCCAATTCGCCGCCGCGCAGCCCCTCCTGGAGCGTACCCGCGATCTGCGCCTAAACC
TGCTGCTGGCCAAGTTTTCAATCCTCAACCGCGATCTCGACGGCTTTCTCTGCTGCCTGAAGGCGACCAA
CTTCCTGCTGCGCGAGCAGTGGGAAGCGGTGCATCCGAAGGGCGAGGACGGCGACTACGCCCTTCGCGCC
GTCACGGTCGAGGCAATCGACGTGTTCCCGACCGTGATCAACCCGCTCCAGTTCCTTCCCCTGATCGAGA
ACCGCAGACACGGCAACCTCAACTACCGTGCTTATCAGGTCGCCATGGGCGAAATTCCCGCCGGCGACGC
CGACGCCGACGGACCTGATCTGGCGGCCATCGAGCGCATCGTCAGCGAGACGGATCTCGACACTCTCAAG
GCAACCAGCGCGCGGTGCTCCGCGGTCGCGGCTGAAATCGCGGGTATCAAACAAACCTGGCACGAGAAGT
TGAACGCGGGGCAACCGATCAGCCTCGACAGGCTCTCCGGCCTGGTTAACGGCATGGCTGCCTGGCTTGC
GGGTCTTGTCGCGTTGCGCGATCCGGCCGCGATCGCTGCAACCGCGGAAGATGTCGGTCCTGTCGATACA
CAGGCGCCGTCAGACACGAGCGGGGTGGTGACTTCATCCGCACAGGCATCTGCAGCGCTTGCAGCGGCGG
CCGACTATTTTGCCCGAATGGAACCATCCAACCCGGCACTGTTGCTGGTGCGTCAAGCGCAGGAGATGGT
GGGCAAGTCATTCATTGAAGTTATGCGGATGCTGGTGCCTGCGCACGTGGAGAGCGCTGCGATCAACATC
GGGCGCGACAAGGTCTTCGACCTGCCGATCGAACGGATGGCGGAACTCGCTACCTCGCTCTCATCGACGG
CAGAGAGCAGCGCTCAAGATATTGTATTTTCAATAGAAAACAGGGCGCAGGCCTTAGGCCTGCTGACGAA
GGTGGCGTCGTTTTTCCGAACCGCGGAGCCGTCCAGCCCCATCCCCTTTTTGGTCGATCGCGCGCGCGAC
CTCGCGCAACGAGATTTTCTCAGCCTTTTGAATGATGTTCTTCCTGAGGGAGCCCTTAAAACAATCGACA
GATCGCATTGA