SecReT6
Protein ID: 27378707
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagblr3596
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3973027..3974895 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ89P87
KEGG IDbja:blr3596
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-84, Aligned region: 30..333
Phage_base_V [PF04717], Evalue: 4.20E-18, Aligned region: 376..466
Protein Sequence: 622 a.a.     [Download]
>gi|27378707|ref|NP_770236.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MGQLTQDTRLCELKTPLGKDVLVFAGFEGSEGLSELFEYRIECLSEDADLDFDRAIGQQCTLTIKLHEKE
REFSGILTEAQWLGVKNDYFSYRIVLRPWLWLLSRTTDCRIFQDKKAPDIIKEVFNERGFTDYESKLTEE
GSCPKLEYCVQYRETDMNFVCRLMEQHGISYFFKHEGGKHTLVLADSKSSHSPIKGLATIPYIPLTGADR
RGEQHIYEWVSERRFRTGKIELNDYNYQKPNAQLISDAKGSEHYTRSEMEYYDYPGKFKEKSDGERYAKI
QLQAEQAMDRRRRGNGDAVNLFPGGLTKLEKHSKDSQNVEYLVVRATHSFSLESYRTGGPGDAGQHVYFG
SYEFLPSDRPFRALMMTPKPRINGIQTAKVVTKDDNSNEEIDVESLGEIYVRFFWDRKKKRSCRLRVAQV
WSGKRWGGQIIPRVGQEVVVEFLEGDPDRPLVIGTVYNDEYKLPYDLPSKKTVAGLKSDSTKGGGGFNEW
NFEDKKGSEKITVHAEKDHDVTVRDTETRTIGEAAFGGDTRKTTLKKGNDKLDIELGGQHITLAMDQSVK
AGISITLTANANITLQVGPSQIILSPAGIVINAPTIAMTAQAGMALAAGGPLVAHGTPTLVG
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|27375111|ref|NC_004463.1|:3973027-3974895 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGGGCCAGCTTACTCAGGATACCCGCCTCTGCGAACTCAAGACGCCTCTTGGCAAGGACGTTCTGGTTT
TTGCCGGGTTCGAAGGCTCGGAAGGTCTCAGCGAACTGTTCGAGTATCGCATCGAGTGTCTCAGTGAGGA
TGCCGACCTCGACTTCGATCGTGCCATCGGTCAGCAGTGTACGCTGACCATAAAGCTGCATGAAAAGGAG
CGCGAGTTCAGTGGCATTCTGACGGAGGCCCAATGGCTCGGGGTGAAGAACGACTATTTCAGCTACCGGA
TCGTTCTGAGGCCCTGGTTATGGCTGTTGTCGCGGACAACTGATTGCCGGATCTTTCAGGACAAGAAGGC
GCCCGACATCATCAAGGAAGTATTCAACGAACGTGGCTTCACCGACTATGAATCCAAACTGACCGAAGAG
GGTTCCTGTCCGAAGCTCGAATATTGCGTTCAGTACCGCGAGACCGACATGAATTTCGTGTGCCGGCTGA
TGGAGCAGCACGGCATCTCCTACTTCTTCAAGCATGAGGGCGGCAAACACACGCTGGTGTTGGCGGACTC
CAAATCGTCGCACAGCCCGATCAAAGGTCTTGCTACGATTCCCTACATCCCGCTGACGGGTGCCGATCGT
CGAGGCGAGCAGCACATCTATGAATGGGTGTCGGAGCGCCGGTTTCGCACCGGCAAGATCGAACTCAACG
ACTACAACTACCAGAAGCCAAACGCTCAGTTGATCAGCGATGCCAAGGGCTCCGAGCATTACACTCGGTC
GGAGATGGAGTATTACGACTATCCCGGGAAGTTCAAGGAAAAGTCCGACGGCGAGCGCTACGCGAAGATC
CAGCTCCAGGCGGAGCAGGCGATGGACCGGCGGCGTCGCGGCAATGGTGACGCGGTCAACCTGTTCCCCG
GTGGGCTGACGAAGCTCGAAAAGCACTCCAAGGACTCGCAGAACGTGGAATATCTCGTGGTGCGAGCCAC
GCACTCGTTCTCGCTCGAATCTTACCGCACTGGCGGTCCCGGCGACGCCGGGCAACATGTCTATTTCGGT
AGCTATGAGTTTCTGCCAAGCGATCGGCCGTTTCGAGCGCTGATGATGACGCCGAAGCCAAGGATTAACG
GCATCCAAACGGCCAAGGTGGTGACCAAAGACGATAATTCGAACGAGGAAATCGACGTTGAATCGCTGGG
CGAAATCTATGTCCGCTTTTTCTGGGATCGGAAGAAGAAGCGGTCGTGCCGGTTGCGCGTGGCTCAGGTT
TGGTCTGGCAAGCGCTGGGGCGGCCAGATCATCCCGCGCGTCGGACAGGAAGTGGTTGTCGAATTCCTGG
AGGGGGATCCGGACCGGCCCCTGGTGATCGGCACCGTGTACAACGACGAATACAAGCTGCCCTATGATTT
GCCGTCGAAGAAGACGGTTGCAGGATTGAAGTCCGACTCCACCAAAGGTGGTGGCGGCTTCAACGAGTGG
AACTTCGAGGACAAGAAGGGATCCGAGAAGATCACGGTGCATGCTGAGAAGGACCACGACGTGACGGTCC
GCGACACCGAGACACGGACCATCGGCGAAGCTGCATTCGGCGGCGACACCCGCAAAACCACGCTCAAGAA
AGGCAATGATAAGCTCGATATCGAATTGGGCGGTCAGCACATCACGCTGGCCATGGACCAGTCTGTCAAA
GCGGGCATCAGCATCACGCTCACGGCCAATGCCAATATCACCCTACAGGTTGGTCCCAGCCAGATTATCC
TGAGCCCGGCGGGCATCGTCATCAACGCGCCGACGATCGCCATGACAGCGCAGGCCGGCATGGCGCTTGC
CGCCGGCGGTCCGCTGGTCGCGCACGGCACTCCAACTCTTGTCGGCTGA