SecReT6
Protein ID: 27378709
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagblr3598
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3975474..3976856 [+]
Producthypothetical protein
NoteFha
UniProt IDQ89P85
KEGG IDbja:blr3598
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-17, Aligned region: 31..97
FHA [PF00498], Evalue: 1.70E-17, Aligned region: 111..127
Protein Sequence: 460 a.a.     [Download]
>gi|27378709|ref|NP_770238.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MMVLRFNIENEPNLPDGGPVSFTVTGRRSVDIGRDRHLDWTLPDPARTISGKHCEVHFRDGGYWLHDVST
NGTFLNGADQRMRGPHRLRDGDRLTIGHYIIGVSLEDEAGGRSPNHEAQLHDPSVQQHADYGELWTADRD
VPPPIDPHLLKKPREAARPVNPGFLDWAASVPAPGVDPFRPSSPTSPYQPSVQDDDMNWAAGPVTAPKPQ
VERPPVKPTPRRPSVWIDDEPAGAQPPASLSHQEVATPRKTQAAGEGPVTAKPVGGTEFARLVARAAGLP
DNFFANKSDAELAEQLGIILRMTVDNLMALLQARTQAKQLTRSTSQTTVQALENNPLKFSPTAEEAMRIL
FGPPTRSYLDAQRAFAQGFSDLKSHQLKTYMAMQHAVHELIADIDPTLMARELELQRGASSWLGTNKGKL
WDEFLTRWKAHLGRDNSAPIEIFMLHFSDYYDRGDKPGSK
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|27375111|ref|NC_004463.1|:3975474-3976856 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGATGGTGCTTCGCTTTAATATCGAGAACGAACCGAACCTTCCGGACGGCGGACCTGTGTCGTTTACGG
TCACCGGCAGGCGCTCGGTCGATATTGGCCGGGATCGTCACCTCGACTGGACGCTGCCGGATCCGGCGCG
GACGATTTCCGGAAAGCACTGCGAAGTGCACTTTCGCGACGGCGGCTATTGGCTGCACGACGTCTCAACC
AACGGCACCTTTCTCAATGGTGCCGACCAGCGCATGCGGGGGCCGCACCGCTTGCGCGACGGCGACCGAC
TGACGATTGGTCACTACATCATCGGAGTTTCGCTGGAGGATGAGGCTGGCGGGCGCAGCCCAAACCATGA
GGCGCAACTGCACGACCCCTCGGTCCAGCAGCATGCCGATTACGGAGAGCTTTGGACGGCCGATCGTGAC
GTTCCGCCGCCGATCGATCCGCACCTGTTGAAGAAGCCACGCGAGGCTGCGCGGCCCGTTAATCCGGGGT
TCCTGGATTGGGCGGCGAGCGTCCCGGCGCCGGGTGTAGACCCATTTCGACCGTCATCGCCGACGTCTCC
GTACCAACCGTCCGTGCAGGACGACGACATGAACTGGGCAGCGGGTCCGGTCACCGCGCCGAAACCGCAA
GTCGAGCGCCCCCCAGTCAAGCCGACCCCACGCCGGCCGTCGGTGTGGATCGATGATGAACCAGCCGGTG
CACAGCCGCCGGCATCGCTATCACACCAAGAGGTTGCGACGCCGCGCAAAACGCAAGCAGCGGGCGAGGG
GCCTGTCACGGCCAAGCCAGTCGGCGGTACCGAGTTCGCGCGACTGGTGGCGCGCGCTGCTGGATTGCCG
GACAATTTTTTTGCCAACAAGTCCGACGCCGAACTCGCCGAACAGCTTGGCATCATCTTGCGTATGACCG
TGGATAATCTCATGGCGCTGCTGCAAGCGCGAACCCAAGCCAAACAGCTGACCCGCAGCACCAGCCAGAC
CACCGTCCAAGCCCTCGAAAATAATCCGCTGAAATTCTCGCCGACCGCGGAAGAGGCGATGCGCATTCTC
TTTGGGCCGCCGACGCGTAGCTACCTCGACGCACAGCGCGCCTTTGCACAGGGCTTCAGTGATCTCAAAT
CACATCAGTTGAAGACCTACATGGCGATGCAGCACGCTGTCCATGAGCTGATTGCGGACATAGATCCGAC
GCTGATGGCGCGCGAGCTCGAGCTTCAGCGTGGCGCAAGCTCCTGGCTCGGCACGAACAAGGGCAAACTC
TGGGACGAGTTCTTGACGCGCTGGAAGGCGCATCTTGGCCGCGATAACAGCGCGCCGATCGAAATCTTTA
TGTTGCACTTCTCGGACTATTACGACCGCGGCGACAAGCCCGGTTCAAAGTAA