SecReT6
Protein ID: 27378710
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagblr3599
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3976893..3978242 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ89P84
KEGG IDbja:blr3599
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.00E-131, Aligned region: 23..444
Protein Sequence: 449 a.a.     [Download]
>gi|27378710|ref|NP_770239.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MDVGMSWYSKVFWSEGLFLRPHHLQQNDRYIEHLLEKRVRYTTPYPWGFAQLEIDKDLTEQSKFAVRNAS
GVMPDGTPFDIPADSPIPEAIDVPETAAGQIVWLMMPVAAPNTREVDEDRTDSASRYVRTSETFIDSTSA
LRIEEEIDIAYPRLSFELRKTSKPGYMGLGIARILEVRDKNILFDDKFVPPMLVCAAHPIIDGWLNRIIG
WVETKLDELARYAVDPSSGGGLQSVDYLVLQVLNRTIPVLTHFQRSGSVHPERLYEELLRFAGELATFST
AERRARNYPAYDHDDLENVFTPLVSDIQDFLSARLGRRAIRLEIIERAQNAFVSPIRDRALFRNATLVLE
VAARRPLVEIQNDFPHLFKVGPNTKMNEIVHANLPGLTLVHLPTPPPHIRAITDHVYFYLDRKSPLWPEF
STAASIGMHFSGDWPELELYLWAILEDRP
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|27375111|ref|NC_004463.1|:3976893-3978242 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGGATGTAGGAATGTCTTGGTACAGCAAGGTTTTCTGGTCGGAAGGTCTGTTTCTGCGGCCGCATCATC
TGCAGCAGAACGACCGCTACATCGAACACTTGCTGGAAAAGCGCGTTCGCTACACGACACCATACCCCTG
GGGCTTTGCCCAGCTGGAGATCGATAAGGATCTTACCGAACAAAGCAAGTTCGCGGTGCGCAATGCGTCC
GGCGTTATGCCGGACGGTACGCCGTTCGATATCCCTGCGGACAGCCCAATTCCCGAAGCGATCGATGTGC
CGGAGACGGCCGCAGGCCAGATCGTCTGGCTGATGATGCCTGTCGCGGCACCAAACACCCGCGAGGTCGA
CGAGGACCGCACCGACAGCGCCAGTCGTTATGTTCGTACTTCGGAAACCTTCATTGACTCGACCTCGGCG
CTACGCATCGAGGAAGAGATCGACATCGCTTATCCGCGCTTGTCGTTCGAACTGCGCAAGACCAGCAAGC
CCGGATACATGGGCCTCGGCATCGCGCGCATTCTGGAAGTGCGCGACAAGAACATCCTGTTCGACGACAA
GTTCGTGCCGCCGATGCTGGTCTGCGCCGCGCATCCGATCATCGATGGTTGGCTCAACCGCATCATCGGC
TGGGTTGAGACCAAACTCGACGAGCTGGCGCGTTACGCGGTCGATCCGTCATCCGGCGGTGGGTTGCAGA
GCGTCGACTATTTGGTCCTGCAAGTGCTGAACCGTACCATTCCCGTGCTGACTCATTTCCAACGCTCCGG
CAGCGTGCACCCCGAGCGCCTGTACGAGGAATTGCTGAGGTTCGCGGGTGAACTTGCGACTTTTTCCACG
GCGGAACGGCGGGCGCGCAACTATCCGGCGTACGATCATGACGATCTCGAGAACGTCTTCACACCATTGG
TGAGCGACATCCAGGACTTCTTGAGCGCGCGGCTGGGCCGGCGGGCGATCCGTCTGGAGATCATCGAGCG
CGCGCAGAATGCGTTCGTATCGCCGATCCGCGATCGAGCGCTATTCCGAAATGCGACCCTGGTGCTGGAG
GTTGCCGCACGGCGGCCACTCGTGGAGATCCAGAACGATTTCCCGCACCTGTTCAAGGTCGGGCCGAACA
CCAAGATGAACGAGATCGTGCACGCAAACTTGCCGGGCCTGACCTTGGTGCATTTGCCGACGCCACCGCC
GCATATCCGGGCCATCACGGATCACGTCTATTTCTATCTCGACCGCAAGTCGCCGCTGTGGCCCGAGTTC
AGCACGGCGGCCTCGATCGGAATGCACTTCTCCGGCGACTGGCCGGAGCTTGAGCTGTACCTTTGGGCTA
TCCTGGAAGACAGGCCATGA