SecReT6
Protein ID: 27378711
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagblr3600
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3978239..3979765 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ89P83
KEGG IDbja:blr3600
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-55, Aligned region: 116..321
OmpA [PF00691], Evalue: 9.80E-14, Aligned region: 400..498
Protein Sequence: 508 a.a.     [Download]
>gi|27378711|ref|NP_770240.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MSDRDKPVNPFGRGERTIIRPNPGGKLPPAPTSQPPPGEGPAARPAYSPSPVPSPGAPTPPSSFSPVPQG
SNYASAPAIHPTEEWISTPAQGQVPQPMLPAGPPLRVDDLVAPNANPVMRAAGPLLQLLGRLRVALMRAS
FASLMEQVADAIKFFEKDIRSAGISEHQANTAKYILCATADDIVQHIPTEERHVWTQYSMLSRFFGERVG
GVRFFEILDHLKIDPLVNYPVLELQHACLALGFQGIHRTSGAGLANLQLIQRNLYELLRRVRPKTMTDLS
PNWRGQALAGRRQRLRVPVWLVAAVVAALLTGSYFVLRTLLAGRAENAAEVALALHPAGPIELKRQVVAP
PPPPPPPPPPDRITQLQRIRNALAKENTACAMTADQTPSFIVIRVCDLALFASGQATILDGFKPIALRVA
ATLDKEPGRIRVVGHTDSSPIRTVRFPTNFELSVERAKAVAAALKPGLTDGSRVDVEGKGADAPIASNTT
PEGRAKNRRVEIFIERSE
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|27375111|ref|NC_004463.1|:3978239-3979765 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGAGCGACAGGGACAAGCCGGTCAATCCTTTCGGTCGGGGCGAACGGACGATCATCCGTCCCAACCCCG
GCGGGAAGTTGCCGCCGGCGCCGACCTCTCAGCCTCCGCCGGGCGAGGGGCCTGCAGCACGTCCGGCCTA
TTCGCCGTCACCCGTACCTTCTCCCGGCGCGCCAACGCCACCATCATCCTTTTCGCCCGTTCCACAGGGC
TCGAACTACGCCTCCGCGCCGGCCATCCATCCAACCGAGGAATGGATCTCGACACCCGCGCAAGGCCAGG
TGCCGCAACCCATGCTGCCGGCAGGGCCGCCGTTGCGCGTCGACGATCTCGTCGCGCCAAATGCCAATCC
AGTGATGCGCGCTGCGGGCCCATTGCTGCAACTGCTCGGTCGGTTGCGGGTGGCGCTCATGCGCGCGTCA
TTCGCGAGCCTGATGGAGCAGGTCGCAGACGCTATCAAATTCTTTGAGAAGGACATCCGTTCAGCGGGCA
TTTCCGAGCACCAGGCCAACACAGCGAAATATATCCTGTGTGCCACTGCCGACGATATCGTGCAGCACAT
CCCGACCGAGGAGCGTCACGTCTGGACGCAATACTCGATGCTGAGCCGCTTCTTCGGCGAGCGTGTCGGC
GGCGTCCGTTTCTTTGAGATCCTCGACCATTTGAAGATTGATCCACTGGTCAATTATCCGGTCCTCGAAC
TTCAGCACGCCTGCTTGGCGCTTGGTTTTCAGGGCATTCACCGGACGTCAGGGGCCGGACTTGCGAACCT
GCAGCTGATCCAGCGTAACCTCTATGAATTGCTGCGCCGGGTCCGGCCGAAGACGATGACCGACCTGTCG
CCCAACTGGCGCGGGCAGGCGCTGGCGGGGCGCCGGCAGCGTTTGCGTGTTCCGGTCTGGCTCGTGGCGG
CCGTCGTCGCCGCGCTGCTGACCGGGTCCTATTTCGTCCTGCGGACGCTCCTCGCTGGCCGGGCAGAGAA
TGCTGCCGAGGTGGCGCTCGCGCTCCATCCGGCCGGCCCGATCGAGCTCAAGCGCCAGGTCGTTGCACCA
CCGCCGCCACCTCCGCCTCCGCCGCCACCGGATCGCATCACCCAGTTGCAACGCATCCGCAACGCGCTCG
CGAAGGAGAACACAGCCTGTGCCATGACCGCGGACCAGACCCCCAGTTTCATCGTGATCAGGGTCTGCGA
TCTGGCCTTGTTTGCATCGGGCCAGGCGACCATCCTCGACGGTTTCAAGCCGATCGCACTCCGCGTCGCA
GCAACCCTCGACAAGGAGCCGGGACGGATCCGGGTCGTCGGCCATACCGACAGTTCGCCGATCCGCACAG
TCCGCTTCCCGACAAATTTCGAGTTGTCGGTCGAGCGCGCCAAGGCGGTTGCTGCGGCACTGAAGCCTGG
CTTGACCGATGGTTCGCGCGTCGACGTCGAGGGCAAAGGAGCAGATGCGCCAATCGCCAGCAACACGACA
CCCGAGGGACGCGCCAAGAACCGGCGCGTCGAGATCTTTATCGAACGCAGCGAATAG