SecReT6
Protein ID: 283779604
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1825
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2315567..2316199 [-]
Producthypothetical protein
NoteTssL
UniProt IDD2QZL6
KEGG IDpsl:Psta_1825
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-23, Aligned region: 26..209
Protein Sequence: 210 a.a.     [Download]
>gi|283779604|ref|YP_003370359.1| hypothetical protein Psta_1825 [Pirellula staleyi DSM 6068]
MTPKFAHAVDPIMLHILSVLDRIAREEKLSPQDERLRIRTLIDQAEAILGSSPDWQLAKYAICSWADEML
VDAPWEGRDWWSNNVLEVELFSTRTCYEQFYERAKEASSLTSRDALEVYYVCVVLGFRGVYRDPELAIYS
IQNLGLPPDIESWAKQASMSVRLGQGRPNMNGKRREISGAPPQRGRMILLWSGLTMILIAATSAVYLFYG
 
Nucleotide Sequence: 633 bp     [Download]
>gi|283777802|ref|NC_013720.1|:c2316199-2315567 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGACGCCCAAGTTTGCCCATGCCGTCGACCCGATCATGCTCCACATCTTGTCGGTGCTCGATCGGATTG
CGCGCGAGGAAAAACTCTCCCCGCAAGATGAGCGACTGCGCATTCGCACACTCATCGATCAGGCCGAAGC
GATTCTCGGCAGTTCGCCCGACTGGCAGCTCGCCAAGTATGCCATTTGCTCGTGGGCCGACGAAATGCTG
GTCGATGCTCCGTGGGAGGGGCGCGATTGGTGGAGCAACAACGTGCTCGAAGTCGAACTCTTCAGCACTC
GTACCTGCTACGAACAGTTCTACGAGCGGGCGAAAGAGGCATCGTCACTCACGTCGCGTGATGCGCTGGA
AGTTTACTACGTTTGTGTCGTCCTCGGCTTTCGCGGCGTCTATCGCGATCCCGAACTAGCGATCTACTCG
ATCCAGAATCTGGGACTCCCTCCCGACATCGAAAGTTGGGCCAAGCAGGCCTCGATGTCGGTGCGACTTG
GCCAAGGTCGCCCCAACATGAATGGGAAGCGTCGCGAGATCAGCGGTGCTCCACCCCAGCGCGGTCGCAT
GATCTTGCTGTGGTCGGGACTCACCATGATCCTCATTGCAGCCACTTCAGCCGTGTATCTGTTTTACGGA
TAA