SecReT6
Protein ID: 283779605
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1826
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2316312..2317784 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDD2QZL7
KEGG IDpsl:Psta_1826
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.30E-90, Aligned region: 18..455
Protein Sequence: 490 a.a.     [Download]
>gi|283779605|ref|YP_003370360.1| type VI secretion protein [Pirellula staleyi DSM 6068]
MRNLPVHWYEGLFLRPHHFQAADRAASEHAATGEQWDHPYNYGLVALDISREALANNQFEVRVLKARMQD
GTLVSLEFGEEPDRLNLRDDVLAMNQALASLEEAFDARPVVRVYLAVPKLKMGRANVANTTDTEPPPRYI
SQRMLSQDEAMGGNEQEIELRNLNVKLLLSTQDRTGYECLPIAQVKRASASNARPQLDDSYIPPVVAIDA
WQYLARDIVRSIYDVIGQKIEVLAGQITSRGVGLESRHPGDLDRLLMLSEINAAYNALAILGFAQGVHPI
AAYTELCRIVGQLSIFAPERRTDPVLPYDHDNLCEIFRDVKLRIETLLNMVRDYEYEQRYFEGVGLGMQV
SLESKWFNSDWQWYVGVNKGDLTTQEIRDLLSPGQLDWKLGSSRQVEILFKQRAEGVRLNPMDRAIRALP
VQQEWVYYEVSKNESPAWRDVQATQTLAMRLKDSLIVNLDRLQGQRQMVISHRGKQVPLQFALFAVPNRQ
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|283777802|ref|NC_013720.1|:c2317784-2316312 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGCGGAATCTACCGGTCCATTGGTACGAAGGTCTCTTCCTAAGGCCCCACCACTTCCAAGCAGCCGATC
GCGCTGCCTCGGAACATGCTGCCACCGGCGAGCAGTGGGATCATCCTTACAACTATGGTCTTGTCGCTCT
CGATATCAGTCGCGAAGCACTCGCCAACAATCAATTCGAAGTGCGTGTGCTCAAAGCCCGCATGCAAGAT
GGCACACTGGTGTCGCTAGAGTTTGGCGAGGAACCTGATCGCCTCAATCTGCGCGATGATGTGCTAGCGA
TGAATCAAGCGCTCGCGAGCCTCGAAGAAGCTTTCGATGCTCGGCCTGTCGTGCGGGTCTATCTCGCCGT
TCCCAAACTGAAAATGGGACGCGCGAATGTCGCCAACACCACCGACACCGAACCACCACCACGCTACATC
TCGCAGCGCATGCTCTCGCAAGACGAAGCGATGGGTGGCAACGAGCAAGAAATCGAGCTGCGCAATCTCA
ACGTCAAACTGCTGCTCTCGACACAAGATCGCACCGGCTACGAATGCTTGCCAATTGCGCAAGTGAAGCG
TGCGAGCGCCAGCAACGCGCGACCCCAGCTCGACGACAGCTATATTCCGCCTGTCGTGGCGATCGATGCC
TGGCAGTATTTAGCACGCGATATTGTCCGCTCGATCTACGACGTCATCGGCCAAAAAATCGAAGTGCTAG
CAGGCCAGATCACCAGCCGCGGTGTCGGCCTCGAAAGCCGCCATCCGGGCGATCTCGATCGTCTGCTGAT
GCTGTCGGAAATCAACGCGGCCTACAACGCACTGGCAATTCTCGGCTTCGCGCAAGGGGTGCATCCTATC
GCGGCCTACACCGAGCTTTGCCGCATCGTTGGTCAACTCTCGATCTTTGCCCCCGAACGACGCACCGATC
CCGTACTTCCGTACGATCACGACAATCTGTGCGAGATTTTCCGCGACGTGAAGCTGCGCATCGAAACGCT
GCTGAACATGGTGCGCGACTACGAGTACGAACAGCGATACTTCGAAGGTGTCGGTCTGGGGATGCAAGTT
TCGCTCGAATCCAAGTGGTTCAACAGCGATTGGCAGTGGTATGTCGGAGTGAACAAGGGTGACCTCACGA
CCCAGGAAATCCGCGACCTGCTTTCGCCCGGCCAACTCGACTGGAAACTCGGTAGCAGTCGGCAGGTGGA
AATCCTGTTCAAACAGCGTGCGGAAGGGGTGCGGCTCAATCCGATGGATCGAGCGATTCGTGCTCTGCCC
GTGCAGCAAGAGTGGGTTTACTACGAGGTGAGCAAGAACGAATCCCCCGCCTGGCGCGATGTGCAAGCAA
CCCAAACGCTGGCAATGCGTCTGAAGGATTCGCTGATCGTGAACCTCGATCGGCTGCAGGGCCAACGCCA
AATGGTGATCTCGCATCGTGGCAAACAAGTGCCGCTGCAGTTCGCACTATTCGCTGTTCCCAACAGACAG
TGA