SecReT6
Protein ID: 283779609
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1830
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2320612..2321706 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDD2QZM1
KEGG IDpsl:Psta_1830
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-21, Aligned region: 56..116
Protein Sequence: 364 a.a.     [Download]
>gi|283779609|ref|YP_003370364.1| type VI secretion-associated protein, ImpA family [Pirellula staleyi DSM 6068]
MISNLDIDKLLAPISEDSPCGENLEYDADYAEMAKAAEGKGDQQFGKTVIAAEEPDWKTVRSLAVSLLGR
SKDLRIADFLTRASIRLDGLPGLHGGLSVIHGLCERFWPTVHPQLDPDDDNDPTIRVNTIATLCDPLTTL
KAVREMPFVKSKLGMFSYRDLLVARGEMPPPASGNKTEMSSLDAAFAECDPNLLLSLAESAKECLRLSMG
IEAVVTDQVGTSNAPNLEDLTDMLRGINKHLQDRVQQRGLNKQPEPEPVEEDAPAESSSGSTATASTSAS
QPMRITGEISSREDVIRTIDKICEYYRRYEPSSPVPLFLNRAKRLASKSFLDILRDLTPDALSQALSLGG
ISDASELQADDDDM
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2320612-2321706 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGATTAGCAACCTAGATATCGATAAACTCCTCGCGCCAATCTCCGAAGATTCGCCGTGTGGAGAGAACC
TTGAGTACGACGCCGACTATGCCGAAATGGCAAAGGCAGCCGAAGGAAAAGGGGACCAGCAGTTCGGAAA
AACGGTGATTGCCGCCGAAGAACCTGACTGGAAAACCGTTCGTTCCCTCGCCGTTTCGCTCCTCGGTCGA
TCAAAAGATCTCCGAATTGCCGACTTCCTGACGCGAGCCTCGATTCGTCTCGATGGCCTCCCAGGACTTC
ACGGCGGACTCTCCGTTATTCACGGTCTCTGCGAGCGATTCTGGCCGACCGTTCACCCGCAACTCGATCC
CGACGACGACAACGATCCCACGATCCGCGTCAACACGATCGCCACGCTGTGCGATCCCCTCACCACCCTC
AAAGCTGTCCGCGAAATGCCGTTTGTGAAGAGCAAACTGGGCATGTTCAGCTACCGCGACCTGCTGGTGG
CTCGTGGCGAAATGCCCCCGCCAGCGTCGGGCAACAAAACAGAAATGTCGTCGCTCGATGCCGCTTTTGC
CGAGTGCGACCCGAATCTTTTGCTATCGCTGGCCGAGAGTGCCAAAGAGTGTTTGCGGCTGTCGATGGGC
ATCGAAGCTGTCGTGACCGATCAGGTGGGGACGTCGAACGCTCCCAACCTCGAAGACCTCACCGACATGC
TGCGGGGCATCAACAAGCACCTGCAAGATCGTGTCCAGCAGCGCGGGCTCAATAAGCAACCCGAGCCAGA
ACCGGTGGAAGAGGATGCCCCGGCGGAGTCGTCCAGCGGATCAACGGCTACAGCTTCAACATCGGCCTCT
CAACCTATGCGAATCACTGGCGAAATCAGCAGCCGCGAAGATGTCATTCGAACGATCGACAAGATCTGCG
AATACTACCGCCGCTACGAACCATCGAGCCCTGTCCCGTTGTTTCTGAATCGTGCCAAGCGTTTGGCGTC
GAAGAGCTTTCTCGACATCTTGCGAGATCTCACTCCCGATGCCTTGTCGCAAGCTCTTTCGCTCGGAGGT
ATCTCCGATGCGAGCGAGTTGCAGGCCGATGACGACGATATGTAA