SecReT6
Protein ID: 283779610
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1831
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2322101..2322613 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDD2QZM2
KEGG IDpsl:Psta_1831
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-62, Aligned region: 10..163
Protein Sequence: 170 a.a.     [Download]
>gi|283779610|ref|YP_003370365.1| type VI secretion protein [Pirellula staleyi DSM 6068]
MAKTSSQKFIARNRAPRVQIEYDVEVYGAEKKVQLPFVMGVMADLSGKPAEPLAAVADRKFLEIDVDNFD
ERLKSMKPRVAFNVPNTLTGEGNVAVDITFESMDDFSPAAVARKVEALNKLLETRTQLANLLTYMDGKSG
AEDLIGKVLKDPSLLQALASAPKPEAPAAE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|283777802|ref|NC_013720.1|:2322101-2322613 Pirellula staleyi DSM 6068 chromosome, complete genome
TTGGCCAAAACCAGCAGCCAGAAGTTCATTGCACGAAACCGTGCCCCTCGCGTGCAGATCGAATACGATG
TGGAAGTTTACGGAGCTGAGAAAAAAGTTCAGCTTCCGTTTGTGATGGGCGTGATGGCCGACTTGTCGGG
TAAGCCTGCTGAACCTCTGGCCGCAGTGGCTGATCGCAAGTTCCTCGAGATCGACGTCGACAACTTCGAC
GAACGCCTCAAGAGCATGAAGCCCCGCGTGGCATTCAACGTCCCCAACACCCTCACCGGTGAAGGCAATG
TGGCCGTTGATATCACCTTCGAGAGCATGGACGACTTCTCACCCGCTGCGGTGGCACGCAAGGTGGAAGC
GCTCAACAAGCTGCTCGAAACCCGCACGCAGCTGGCCAACCTGCTGACGTACATGGACGGCAAGAGTGGC
GCCGAAGACCTCATCGGCAAGGTCCTCAAAGATCCTTCGCTGTTGCAAGCTCTGGCCTCGGCTCCCAAGC
CGGAAGCCCCCGCTGCTGAATAA